KEGG   Saccharomyces cerevisiae (budding yeast): YCL043CHelp
Entry
YCL043C           CDS       T00005                                 

Gene name
PDI1, MFP1, TRG1
Definition
(RefSeq) protein disulfide isomerase PDI1
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YCL043C (PDI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sce03110]
    YCL043C (PDI1)
   04131 Membrane trafficking [BR:sce04131]
    YCL043C (PDI1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YCL043C (PDI1)
Enzymes [BR:sce01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     YCL043C (PDI1)
Chaperones and folding catalysts [BR:sce03110]
 Protein folding catalysts
  Protein disulfide isomerase
   YCL043C (PDI1)
Membrane trafficking [BR:sce04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    YCL043C (PDI1)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   YCL043C (PDI1)
  Exosomal proteins of colorectal cancer cells
   YCL043C (PDI1)
  Exosomal proteins of bladder cancer cells
   YCL043C (PDI1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 OST3_OST6 AhpC-TSA Thioredoxin_7 Thioredoxin_8 Thioredoxin_2 TraF
Motif
Other DBs
NCBI-GeneID: 850314
NCBI-ProteinID: NP_009887
SGD: S000000548
UniProt: P17967
Structure
PDB: 

Position
III:complement(48653..50221)
Genome map
AA seq 522 aa AA seqDB search
MKFSAGAVLSWSSLLLASSVFAQQEAVAPEDSAVVKLATDSFNEYIQSHDLVLAEFFAPW
CGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQDLCMEHNIPGFPSLKIFKNSDVNNSI
DYEGPRTAEAIVQFMIKQSQPAVAVVADLPAYLANETFVTPVIVQSGKIDADFNATFYSM
ANKHFNDYDFVSAENADDDFKLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPY
FGEIDGSVFAQYVESGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGR
HAGNLNMKEQFPLFAIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIESLVKDFLKGD
ASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVLYYAPWCGHCKRLAPTYQELA
DTYANATSDVLIAKLDHTENDVRGVVIEGYPTIVLYPGGKKSESVVYQGSRSLDSLFDFI
KENGHFDVDGKALYEEAQEKAAEEADADAELADEEDAIHDEL
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgaagttttctgctggtgccgtcctgtcatggtcctccctgctgctcgcctcctctgtt
ttcgcccaacaagaggctgtggcccctgaagactccgctgtcgttaagttggccaccgac
tccttcaatgagtacattcagtcgcacgacttggtgcttgcggagttttttgctccatgg
tgtggccactgtaagaacatggctcctgaatacgttaaagccgccgagactttagttgag
aaaaacattaccttggcccagatcgactgtactgaaaaccaggatctgtgtatggaacac
aacattccagggttcccaagcttgaagattttcaaaaacagcgatgttaacaactcgatc
gattacgagggacctagaactgccgaggccattgtccaattcatgatcaagcaaagccaa
ccggctgtcgccgttgttgctgatctaccagcttaccttgctaacgagacttttgtcact
ccagttatcgtccaatccggtaagattgacgccgacttcaacgccaccttttactccatg
gccaacaaacacttcaacgactacgactttgtctccgctgaaaacgcagacgatgatttc
aagctttctatttacttgccctccgccatggacgagcctgtagtatacaacggtaagaaa
gccgatatcgctgacgctgatgtttttgaaaaatggttgcaagtggaagccttgccctac
tttggtgaaatcgacggttccgttttcgcccaatacgtcgaaagcggtttgcctttgggt
tacttattctacaatgacgaggaagaattggaagaatacaagcctctctttaccgagttg
gccaaaaagaacagaggtctaatgaactttgttagcatcgatgccagaaaattcggcaga
cacgccggcaacttgaacatgaaggaacaattccctctatttgccatccacgacatgact
gaagacttgaagtacggtttgcctcaactctctgaagaggcgtttgacgaattgagcgac
aagatcgtgttggagtctaaggctattgaatctttggttaaggacttcttgaaaggtgat
gcctccccaatcgtgaagtcccaagagatcttcgagaaccaagattcctctgtcttccaa
ttggtcggtaagaaccatgacgaaatcgtcaacgacccaaagaaggacgttcttgttttg
tactatgccccatggtgtggtcactgtaagagattggccccaacttaccaagaactagct
gatacctacgccaacgccacatccgacgttttgattgctaaactagaccacactgaaaac
gatgtcagaggcgtcgtaattgaaggttacccaacaatcgtcttatacccaggtggtaag
aagtccgaatctgttgtgtaccaaggttcaagatccttggactctttattcgacttcatc
aaggaaaacggtcacttcgacgtcgacggtaaggccttgtacgaagaagcccaggaaaaa
gctgctgaggaagccgatgctgacgctgaattggctgacgaagaagatgccattcacgat
gaattgtaa

DBGET integrated database retrieval system