KEGG   Saccharomyces cerevisiae (budding yeast): YCL044CHelp
Entry
YCL044C           CDS       T00005                                 

Gene name
MGR1
Definition
(RefSeq) Mgr1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mgr1 MBR1
Motif
Other DBs
NCBI-GeneID: 850313
NCBI-ProteinID: NP_009886
SGD: S000000549
UniProt: P25573
Position
III:complement(47111..48364)
Genome map
AA seq 417 aa AA seqDB search
MAVFTPPSGNSNSTDHTHTQDDHDKDDNDIKKFYIRPSLGLKLWGPLVPAPDNLPGLYTL
ITIQSAVGFFALWRLRRLYKLPPPRRIATGTHSDLSFGELPSEMIVNGKTKIKKDIADFP
TLNRFSTTHGDIVLAPPPIIPRQSRFVSVRKLLWGLFGSLLLSQSLLELTRLNFLKYDPW
CDEMKSVRDKKFFNNIVKYYHEGIDPTKIKVKDAMNGTPLSTNIPEVKQSVALARAQVEA
QNPIIKWFGPLEYKPMSFNEYLNRMEFHLDMFEFFQNKRNIRENSIELINSISHNPQSSS
TGLEGLSESKKLHLQNVEKRLHFLASSGDSISAPVKKRSSTTLSRGVILPHDTKGPQDID
LDTIRSLYDPWMTLALETSLSIKFIPTTMPSHTKTPTSTDQPLPGPTPKALTNEKTH
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggctgtatttactcctccatcaggtaatagcaattccaccgaccatactcacacacaa
gatgaccacgacaaagatgataatgatatcaagaaattctacataaggccaagtttaggc
ttaaaactgtggggtccgctcgtacccgctcctgataacctaccgggactatacactcta
atcactatccaatctgcagtgggtttctttgccctttggagactgagaaggctctacaaa
ctaccgccaccgcgccgcattgccactggcactcactcggatttatcctttggcgaacta
cccagtgaaatgattgtcaatggcaagactaaaatcaaaaaggatattgctgactttcca
actttgaaccgcttctccaccacccatggtgacattgtgctcgcccctcctcccatcata
cctcgccaatctcgattcgtcagcgtcagaaagctcttatgggggttgtttggctctttg
ctactttctcagtcactgttggagcttactcgcctgaactttcttaaatacgacccctgg
tgcgacgaaatgaaatccgtacgtgacaagaagtttttcaacaatattgtcaaatattat
cacgagggcatagaccccaccaaaataaaagtcaaggatgctatgaacggtactcctctc
tcgacaaatatccctgaggtcaaacaaagcgtcgctctcgctagagcgcaagttgaggcg
cagaatcccattattaaatggttcggacccttggaatacaagcccatgtctttcaacgag
tacctcaatcgcatggaatttcacttggacatgttcgagttttttcaaaataaaagaaac
attagagaaaattccattgaactcatcaattccatatcccacaatccgcagtcttcttct
actggccttgaaggtctttccgagtccaaaaaactccatctacaaaatgtggaaaaaaga
ctgcatttcttagcatcttcgggagattccatttccgcaccagtaaagaagagatccagc
accacactctcccgaggtgtcattttgccccatgacacgaaaggcccgcaagatattgat
ctcgatacaataagatcgctttatgatccatggatgactttggccttagaaacttcgcta
agcatcaaattcataccaactaccatgccctcccataccaagacacccactagcacggac
cagccgttaccagggcctacccccaaggctctcactaatgaaaagacacattag

DBGET integrated database retrieval system