KEGG   Saccharomyces cerevisiae (budding yeast): YCL047CHelp
Entry
YCL047C           CDS       T00005                                 

Gene name
POF1
Definition
(RefSeq) nicotinamide-nucleotide adenylyltransferase
  KO
K19785  nicotinamide-nucleotide adenylyltransferase [EC:2.7.7.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00760  Nicotinate and nicotinamide metabolism
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    YCL047C (POF1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     YCL047C (POF1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like ATP-sulfurylase ATP-synt_G
Motif
Other DBs
NCBI-GeneID: 850310
NCBI-ProteinID: NP_009883
SGD: S000000552
UniProt: P25576
Position
III:complement(43661..44437)
Genome map
AA seq 258 aa AA seqDB search
MKKTFEQFRKSNLLFQVLKGPQHLECQKLFVLDSSFNPPHLAHFQLLSQTIKNFKLKDTR
SHVLLLLAVNNADKLPKPASFPTRLEMMCLFADYLQEKLPQSVVSVGLTVFSKFIDKDKI
LHEQFVKGCSADIGYLVGFDTIARIFDEKYYHPLKISDVMESFMSGSQLYCLARGDCHLS
AESQLRYASDILEGKFEPVIPREWGARIHVMQNDYPALRNVSSSEIRNKLKNGQVESLKD
ELPLCIYDYLINNKTIFD
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagacgttcgagcagtttcgaaaaagcaatttactatttcaggttctcaaagga
ccccagcatctagaatgtcagaagttatttgtccttgattcttcattcaatccaccacat
ctggcccattttcaactactatcgcagactattaaaaacttcaaattgaaggacacccgt
tcgcatgttttattactgttagcggtgaataatgcagataagttgcctaagccggcatct
tttccaactcgtctggaaatgatgtgcttattcgctgactaccttcaggagaagctcccc
caatctgtagtatctgtcgggttgactgttttctcgaaattcatcgacaaggacaaaata
ttacatgagcaatttgttaaaggatgcagtgcagatataggctacttagttggttttgat
acaattgctaggatctttgatgaaaaatattatcatcctttaaaaatcagtgatgtaatg
gagagcttcatgtcgggatctcaattatattgcttggcgagaggcgattgccatctcagt
gctgaatcgcaactaagatacgccagtgacatccttgagggaaaattcgaaccggtaata
ccaagagaatggggcgctaggattcatgttatgcaaaatgattatccagcattaagaaat
gtttcatcatccgagattaggaacaaactgaagaatgggcaagtggagagtttgaaagac
gagttgccattgtgcatatacgattatttgatcaataataagacaatatttgattga

DBGET integrated database retrieval system