KEGG   Saccharomyces cerevisiae (budding yeast): YCL057W
Entry
YCL057W           CDS       T00005                                 

Gene name
PRD1
Definition
(RefSeq) metalloendopeptidase
  KO
K01405  saccharolysin [EC:3.4.24.37]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sce01002]
    YCL057W (PRD1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.37  saccharolysin
     YCL057W (PRD1)
Peptidases and inhibitors [BR:sce01002]
 Metallo peptidases
  Family M3
   YCL057W (PRD1)
SSDB
Motif
Pfam: Peptidase_M3
Other DBs
NCBI-GeneID: 850301
NCBI-ProteinID: NP_009874
SGD: S000000562
UniProt: P25375
Position
III:24768..26906
AA seq 712 aa
MRLLLCKNWFASPVISPLLYTRSLYSMANTTSFPIAPQAPPNWSFTPSDISGKTNEIINN
SNNFYDSMSKVESPSVSNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKL
DELNIDLSLRHDIFLQFARVWQDVQSKADSVERETFKYVEKSYKDYIHSGLELDEGNRLK
IKEIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKV
TFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANY
NLYDKMAEDSTTVMNFLNDLKDKLIPLGRKELQVLQDMKAEDVKKLNQGADPNYYIWDHR
YYDNKYLLENFNVDLEKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVK
QIAVWNMDDPKSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFMIDDTTRSYPVTALVCNF
SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW
TWNKNELINLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQ
NLSICDTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK
FAKDPLNAKNGIQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQN
NT seq 2139 nt   +upstreamnt  +downstreamnt
atgcgattgttgctgtgcaagaattggtttgcgtcacctgtaatctcaccactactgtat
acccgctccttatattcaatggctaacactactagtttccctattgctccccaggccccg
cctaattggtcgttcactcccagcgatattagtgggaaaaccaacgaaatcatcaacaac
agcaacaatttctatgattctatgagtaaggtagagagcccttccgtgagtaattttgtg
gagcctttcatgaagtttgaaaatgaattgggcccaataattaaccaattaactttctta
cagcatgtgtcgtctgataaagaaattagggacgcatctgtgaactcctcaatgaaactg
gatgagttgaacatcgatctatctctgcgtcacgacatctttttgcaattcgcccgcgtc
tggcaggatgttcaatcgaaggcagattctgtggaaagagaaactttcaaatacgttgag
aagtcttacaaggactacattcattctggtttggaacttgacgagggaaaccgattgaaa
atcaaagagatcaaaaagaagatctccgttaactctattaatttttcgaagaatctggga
gaacaaaaggaatacatcactttcaccaaagaacaattggaaggtgtgccggattctatt
ttgacgcagttcgagacaataaaatctgacaaagatagcaatgaaaccttgtataaagtc
accttcaaatatccggacatttttcccgtgatgaaattggcatcctcagctcagactaga
aagcaggcctttttggccgaccaaaataaggtccctgaaaatgaagctatactgttggat
acattgaagctgcgtgacgaattggcctcgttattgggctatgacacgtatgcgaactac
aacctgtatgataaaatggctgaagatagcactacggtaatgaactttttgaatgatttg
aaggacaagctaattccgctgggcagaaaggaactacaggtcttgcaagatatgaaagcc
gaagatgttaagaaacttaaccagggtgcagatccaaactactacatttgggaccaccgt
tactacgataacaaatatttgttagaaaacttcaatgtggacctagaaaagatttctgaa
tattttccactagaggctacgattactggtatgctggaaatatacgaaacattgtttaat
ttgaagtttatcgagacgaaagattctcaaaacaaatctgtttggcatgacgacgtcaaa
caaatcgccgtttggaatatggatgatccaaagtctccaaactttgttggttggatttat
ttcgatttacatcctcgtgatggtaaatatggccacgctgccaattttggtttatcgtca
tcattcatgattgatgacaccacaagatcgtatccggttactgcgttggtttgcaatttc
tccaaatctacgaaggataaaccttctctactgaagcataacgaaatagtgacctttttc
catgaattgggccatggtatccatgacctggtgggacaaaacaaggaatcgaggtttaat
ggccccggatctgttccatgggattttgtggaggcaccttcccaaatgttagaattttgg
acttggaataagaatgaattaatcaacctctcatcacattacaaaacgggcgaaaaaatt
ccagaatctttgatcaattcattgatcaaaactaaacacgtaaatggtgctttattcact
ctaagacaattacattttgggttatttgatatgaaagtacatacttgtaaagacttgcaa
aacctgtcaatttgcgatacctggaaccaattgagacaggatatttctttgatttctaat
ggtggtacgttatccaagggttatgattcatttggccatataatgtcagactcttactct
gccggttattacggttatctatgggcggaagtctttgcaactgatatgtatcacaccaaa
ttcgctaaggatccgttaaatgccaagaatgggatacaataccgtgatattgtgttggct
cgtggtggcctttatgatattaatgataatctgaaagaatttttgggtagggaaccttct
aaggatgctttcttgaaggagctgggcttacagaactaa

DBGET integrated database retrieval system