KEGG   Saccharomyces cerevisiae (budding yeast): YCR004CHelp
Entry
YCR004C           CDS       T00005                                 

Gene name
YCP4
Definition
(RefSeq) flavodoxin-like fold family protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FMN_red Flavodoxin_2 Flavodoxin_1
Motif
Other DBs
NCBI-GeneID: 850360
NCBI-ProteinID: NP_009930
SGD: S000000597
UniProt: P25349
Position
III:complement(119575..120318)
Genome map
AA seq 247 aa AA seqDB search
MVKIAIITYSTYGHIDVLAQAVKKGVEAAGGKADIYRVEETLPDEVLTKMNAPQKPEDIP
VATEKTLLEYDAFLFGVPTRFGNLPAQWSAFWDKTGGLWAKGSLNGKAAGIFVSTSSYGG
GQESTVKACLSYLAHHGIIFLPLGYKNSFAELASIEEVHGGSPWGAGTLAGPDGSRTASP
LELRIAEIQGKTFYETAKKLFPAKEAKPSTEKKTTTSDAAKRQTKPAAATTAEKKEDKGL
LSCCTVM
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagattgcgataattacttactctacctacgggcacatagacgttttagcccaa
gctgttaagaaaggtgtggaggcagctggtggtaaagctgatatatacagggtcgaggaa
actttacctgatgaagtcctcaccaagatgaacgctcctcagaaacctgaagatattcct
gttgccactgagaaaacgttgctcgaatatgacgcctttttgttcggtgttccaactagg
tttggtaatttgccggctcaatggtccgccttttgggataaaaccggtggattatgggcc
aagggctctttgaacggcaaagctgcggggatattcgttagtacttccagttacggaggt
ggtcaagaaagtaccgttaaagcctgtttgtcttatttagctcatcacggaattatcttt
ttaccactgggttataagaattcatttgctgagttagccagtatagaagaggtacacggt
ggctctccatggggtgctggtacccttgcaggacctgacggctcaagaactgcgtctcca
cttgaattgagaattgctgaaattcaaggtaaaacattctacgaaaccgccaaaaaactt
ttccctgcaaaagaagccaagccctccactgaaaagaagaccactacttctgatgcggct
aagagacaaactaaacctgcagcagctacaactgcagaaaagaaggaggacaaaggatta
ttatcctgctgtactgtcatgtaa

DBGET integrated database retrieval system