KEGG   Saccharomyces cerevisiae (budding yeast): YCR005CHelp
Entry
YCR005C           CDS       T00005                                 

Gene name
CIT2
Definition
(RefSeq) citrate (Si)-synthase CIT2
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00020  Citrate cycle (TCA cycle)
sce00630  Glyoxylate and dicarboxylate metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
sce01200  Carbon metabolism
sce01210  2-Oxocarboxylic acid metabolism
sce01230  Biosynthesis of amino acids
Module
sce_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sce_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
sce_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YCR005C (CIT2)
   00630 Glyoxylate and dicarboxylate metabolism
    YCR005C (CIT2)
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     YCR005C (CIT2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Citrate_synt
Motif
Other DBs
NCBI-GeneID: 850361
NCBI-ProteinID: NP_009931
SGD: S000000598
UniProt: P08679
Position
III:complement(120946..122328)
Genome map
AA seq 460 aa AA seqDB search
MTVPYLNSNRNVASYLQSNSSQEKTLKERFSEIYPIHAQDVRQFVKEHGKTKISDVLLEQ
VYGGMRGIPGSVWEGSVLDPEDGIRFRGRTIADIQKDLPKAKGSSQPLPEALFWLLLTGE
VPTQAQVENLSADLMSRSELPSHVVQLLDNLPKDLHPMAQFSIAVTALESESKFAKAYAQ
GISKQDYWSYTFEDSLDLLGKLPVIAAKIYRNVFKDGKMGEVDPNADYAKNLVNLIGSKD
EDFVDLMRLYLTIHSDHEGGNVSAHTSHLVGSALSSPYLSLASGLNGLAGPLHGRANQEV
LEWLFALKEEVNDDYSKDTIEKYLWDTLNSGRVIPGYGHAVLRKTDPRYMAQRKFAMDHF
PDYELFKLVSSIYEVAPGVLTEHGKTKNPWPNVDAHSGVLLQYYGLKESSFYTVLFGVSR
AFGILAQLITDRAIGASIERPKSYSTEKYKELVKNIESKL
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgacagttccttatctaaattcaaacagaaatgttgcatcatatttacaatcaaattca
agccaagaaaagactctaaaagagagatttagcgaaatctaccccatccatgctcaagat
gtaaggcaattcgttaaagagcatggcaaaactaaaattagcgatgttctattagaacag
gtatatggtggtatgagaggtattccagggagcgtatgggaaggttccgttttggaccca
gaagacggtattcgtttcagaggtcgtacgatcgccgacattcaaaaggacctgcccaag
gcaaaaggaagctcacaaccactaccagaagctctcttttggttattgctaactggcgag
gttccaactcaagcgcaagttgaaaacttatcagctgatctaatgtcaagatcggaacta
cctagtcatgtcgttcaacttttggataatttaccaaaggacttacacccaatggctcaa
ttctctattgctgtaactgccttggaaagcgagtcaaagtttgctaaggcttatgctcaa
ggaatttccaagcaagattattggagttatacttttgaagattcactagacttgctgggt
aaattgccagttattgcagctaaaatttatcgtaatgtattcaaagatggcaaaatgggt
gaagtggacccaaatgccgattatgctaaaaatctggtcaacttgattggttctaaggat
gaagatttcgtggacttgatgagactttatttaaccattcattcggatcacgaaggtggt
aatgtatctgcacatacatcccatcttgtgggctcagcactatcatcaccttatctgtcc
cttgcatcaggtttgaacgggttggctggcccacttcatgggcgtgctaatcaagaagta
ctagaatggttatttgcacttaaagaagaggtaaatgatgactactctaaagatacgatc
gaaaaatatttatgggatactctaaactcaggaagagtcattcccggttatggtcatgct
gtgctaaggaaaactgatcctcgttatatggctcagcgtaagtttgccatggaccatttt
ccagattatgaattattcaagttagtttcatcaatatacgaggtagcacctggcgtattg
actgaacatggtaaaaccaaaaatccatggccaaatgtagatgctcactctggtgtctta
ttacaatattatggactaaaagaatcttctttctataccgttttatttggcgtttcaagg
gcatttggtattcttgctcaattgatcactgatagggccatcggtgcttccattgaaagg
ccaaagtcctattctactgagaaatacaaggaattggtcaaaaacattgaaagcaaacta
tag

DBGET integrated database retrieval system