KEGG   Saccharomyces cerevisiae (budding yeast): YCR009C
Entry
YCR009C           CDS       T00005                                 

Symbol
RVS161, END6, FUS7, SPE161
Name
(RefSeq) amphiphysin-like protein RVS161
  KO
K20120  bridging integrator 3
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YCR009C (RVS161)
Membrane trafficking [BR:sce04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   N-BAR proteins
    YCR009C (RVS161)
SSDB
Motif
Pfam: BAR DUF1496 HAUS-augmin3 DUF2303 Jnk-SapK_ap_N DUF4164 GAS
Other DBs
NCBI-GeneID: 850367
NCBI-ProteinID: NP_009935
SGD: S000000602
UniProt: P25343
Position
III:complement(130745..131542)
AA seq 265 aa
MSWEGFKKAINRAGHSVIIKNVDKTIDKEYDMEERRYKVLQRAGEALQKEAKGFLDSLRA
VTASQTTIAEVISNLYDDSKYVAGGGYNVGNYYLQCVQDFDSETVKQLDGPLRETVLDPI
TKFSTYFKEIEEAIKKRDHKKQDFDAAKAKVRRLVDKPAKDASKLPRAEKELSLAKDIFE
NLNNQLKTELPQLVSLRVPYFDPSFEALIKIQLRFCTDGYTRLAQIQQYLDQQSRDDYAN
GLLDTKIEELLGQMTSLDICALGIK
NT seq 798 nt   +upstreamnt  +downstreamnt
atgagttgggaaggttttaagaaagctatcaacagagctggtcacagtgtgataattaag
aatgtcgacaagaccattgataaagagtatgacatggaagaacgtcgttataaagttctt
caaagagcaggtgaggcattacaaaaggaagccaaaggtttcttggactcattgagagct
gtgacagcatcacagactaccattgccgaggtcatctctaacctctatgacgattcaaaa
tatgttgctggtggtggttacaacgttggtaactattatttgcaatgtgttcaagatttt
gatagcgaaactgttaagcaattagacgggcccttaagagaaaccgtactagatccaata
acaaagttttcgacgtatttcaaagaaattgaggaggccataaaaaagagagaccataag
aaacaagacttcgatgctgcgaaggcaaaagttcgtagattagtggacaaacctgctaaa
gatgcctctaaactgccaagggctgaaaaagaattgagcttagctaaagatattttcgaa
aatcttaataaccaattgaaaactgaactaccacagttagtttcattaagagtaccttac
tttgacccaagttttgaagctttaatcaagattcagctaaggttctgtactgatggttac
actcgtttagcgcagattcaacaatatttggaccaacaatcaagagacgactatgccaat
gggttattagacactaaaatcgaagaactattaggacaaatgacaagcctagatatttgt
gcgctcgggataaaataa

DBGET integrated database retrieval system