KEGG   Saccharomyces cerevisiae (budding yeast): YCR028C-AHelp
Entry
YCR028C-A         CDS       T00005                                 

Gene name
RIM1
Definition
(RefSeq) Rim1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSB
Motif
Other DBs
NCBI-GeneID: 850395
NCBI-ProteinID: NP_009958
SGD: S000007222
UniProt: P32445
Structure
PDB: 

Position
III:complement(join(172950..173115,173199..173440))
Genome map
AA seq 135 aa AA seqDB search
MFLRTQARFFHATTKKMDFSKMSIVGRIGSEFTEHTSANNNRYLKYSIASQPRRDGQTNW
YNITVFNEPQINFLTEYVRKGALVYVEADAANYVFERDDGSKGTTLSLVQKDINLLKNGK
KLEDAEGQENAASSE
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgtttttacgtactcaagctcgtttcttccatgctactaccaagaagatggacttctcg
aaaatgtccatcgtcggccgcattggctctgaattcactgaacatacttctgctaataac
aatcgttatttgaaatatagtatcgcttcgcaaccaagaagagatggccaaaccaattgg
tataatatcaccgttttcaatgaacctcaaatcaattttttgacagaatatgttagaaaa
ggcgctttggtatatgttgaagcagatgctgctaactatgtcttcgagagagacgacggt
tctaagggtactactttgagcttagttcaaaaggacattaatttattgaagaatgggaag
aaattagaagatgctgagggccaagaaaatgctgcttcttcagaataa

DBGET integrated database retrieval system