KEGG   Saccharomyces cerevisiae (budding yeast): YCR031CHelp
Entry
YCR031C           CDS       T00005                                 

Gene name
RPS14A, CRY1, RPL59
Definition
(RefSeq) ribosomal 40S subunit protein S14A
  KO
K02955  small subunit ribosomal protein S14e
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03010  Ribosome
Module
sce_M00177  Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    YCR031C (RPS14A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sce03011]
    YCR031C (RPS14A)
Ribosome [BR:sce03011]
 Ribosomal Proteins
  Eukaryotes
   Small subunit
    YCR031C (RPS14A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S11 DUF814
Motif
Other DBs
NCBI-GeneID: 850397
NCBI-ProteinID: NP_009960
SGD: S000000627
UniProt: P06367
Structure
PDB: 

Position
III:complement(join(177500..177906,178214..178220))
Genome map
AA seq 137 aa AA seqDB search
MSNVVQARDNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAA
MLAAQDVAAKCKEVGITAVHVKIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTP
VPSDSTRKKGGRRGRRL
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacgttgttcaagctcgtgacaattcccaagtttttggtgttgctagaatttac
gcttctttcaacgatactttcgttcatgttaccgatttatctggtaaggaaaccatcgcc
agagttactggtggtatgaaggttaaggctgacagagatgaatcttctccatacgctgct
atgttggctgcccaagatgttgccgctaagtgtaaggaagtcggtatcactgccgttcac
gttaagatcagagctaccggtggtactagaaccaagactccaggtccaggtggtcaagct
gctttgagagctttggccagatctggtttgagaattggccgtatcgaagatgttacccca
gttccatctgactccaccagaaagaagggtggtagaagaggtagaagattatga

DBGET integrated database retrieval system