KEGG   Saccharomyces cerevisiae (budding yeast): YCR052W
Entry
YCR052W           CDS       T00005                                 

Gene name
RSC6
Definition
(RefSeq) Rsc6p
  KO
K11760  chromatin structure-remodeling complex subunit RSC6
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YCR052W (RSC6)
   03036 Chromosome and associated proteins [BR:sce03036]
    YCR052W (RSC6)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    RSC complex
     YCR052W (RSC6)
Chromosome and associated proteins [BR:sce03036]
 Eukaryotic type
  Chromatin remodeling factors
   RSC complex
    YCR052W (RSC6)
SSDB
Motif
Pfam: SWIB
Other DBs
NCBI-GeneID: 850419
NCBI-ProteinID: NP_009981
SGD: S000000648
UniProt: P25632
Position
III:214994..216445
AA seq 483 aa
MVTQTNPVPVTYPTDAYIPTYLPDDKVSNLADLKKLIEMDSRLDLYLTRRRLDTSINLPT
NTKTKDHPPNKEMLRIYVYNTTESSPRSDSGTPADSGKTTWTLRIEGKLLHESANGKHPF
SEFLEGVAVDFKRLKPLGMGKKRKRDSSLSLPLNLQQPEYNDQDSTMGDNDNGEDEDSAE
AESREEIVDALEWNYDENNVVEFDGIDIKRQGKDNLRCSITIQLRGVDGGKVQYSPNLAT
LIGMQTGSVNDAVYSIYKYILINNLFVTEQTEAQDGSNDAEDSSNENNNKNGAGDDDGVE
GSTPKDKPELGEVKLDSLLQKVLDTNAAHLPLMNVVQTVNKLVSPLPPIILDYTIDLSKD
TTYGATTLDVDVSHILHQPQPQPNLQKEEETDAEDTAKLREITKLALQLNSSAQKYQFFH
ELSLHPRETLTHYLWSSKQNELVLQGDQYFNEDAARTSDIYSNNNNDRSLMGNISLLYSQ
GRL
NT seq 1452 nt   +upstreamnt  +downstreamnt
atggtaacacagaccaatccggtccctgttacatatccaacggatgcttatatccccacg
tatctgcccgatgataaggtctccaatctggcagatttgaaaaaattgatagaaatggat
tccagactagatttgtatctgacaagaaggaggctggatacgtccatcaatttacctaca
aacaccaagaccaaggaccatccccccaataaagagatgctgaggatttacgtctacaac
actacggaaagcagccctcgcagcgattctggcaccccagcggactcaggcaagactaca
tggacactgagaatagaaggtaagcttctgcacgagtccgcaaacggaaagcacccattt
agtgagtttttggaaggtgtcgcggtcgactttaaaagactgaaaccgctgggcatgggc
aagaagaggaaacgcgattcgtcattgagccttcctttgaatctgcaacaacccgaatac
aatgatcaagatagcaccatgggcgataacgacaacggcgaggatgaggacagtgcagag
gcagaatccagggaggaaattgtagacgcactggaatggaactacgatgaaaacaacgtt
gtggagtttgatggtatcgacatcaagaggcaaggcaaggataatttgcgatgcagtata
accatccagttgaggggtgtcgacggtggaaaagtacagtactcgcccaacttagctacc
ttgataggtatgcaaacgggctccgttaatgacgcggtttattcgatctacaagtacatt
ttgatcaacaatctgtttgttacggaacaaacagaggctcaagatggttccaacgatgcc
gaagacagcagtaacgagaataacaataaaaacggtgctggtgacgatgatggcgtcgag
ggaagtactccaaaggataagcccgaattgggtgaagtgaagctagattcactcttacaa
aaggtattggatacaaacgccgcgcacctccccttgatgaatgttgtgcaaaccgtgaac
aaactggtatcacccctaccgcccatcatcctagattatacaattgatctttccaaagat
accacctatggtgctaccaccttggatgtagatgtgtcgcacattctccaccagcctcaa
ccccagccaaatttacaaaaagaggaagaaacagatgctgaagacacagcaaaactacgt
gaaatcacaaagcttgccttgcagttgaactctagtgctcaaaaataccagtttttccac
gaactgtctttgcatccaagagaaacgctgactcactacttatggtcttccaagcaaaac
gagcttgtgctgcagggcgaccaatacttcaatgaagatgctgcaagaacgagtgacata
tacagtaacaacaacaatgacaggtcactaatgggcaatatctcactactgtactcccaa
ggaagactataa

DBGET integrated database retrieval system