KEGG   Saccharomyces cerevisiae (budding yeast): YCR063W
Entry
YCR063W           CDS       T00005                                 

Gene name
BUD31, CWC14
Definition
(RefSeq) U2 snRNP complex subunit BUD31
  KO
K12873  bud site selection protein 31
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    YCR063W (BUD31)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sce03041]
    YCR063W (BUD31)
Spliceosome [BR:sce03041]
 Complex B
  Other components
   Prp19-related factors
    YCR063W (BUD31)
 Complex C
    YCR063W (BUD31)
SSDB
Motif
Pfam: G10
Other DBs
NCBI-GeneID: 850427
NCBI-ProteinID: NP_009990
SGD: S000000659
UniProt: P25337
Structure
PDB: 

Position
III:228318..228791
AA seq 157 aa
MPRIKTRRSKPAPDGFEKIKPTLTDFEIQLRDAQKDKSSKLAAKSNEQLWEIMQLHHQRS
RYIYTLYYKRKAISKDLYDWLIKEKYADKLLIAKWRKTGYEKLCCLRCIQKNETNNGSTC
ICRVPRAQLEEEARKKGTQVSFHQCVHCGCRGCASTD
NT seq 474 nt   +upstreamnt  +downstreamnt
atgccgcgcataaagaccagaagatccaagcctgcacctgacgggttcgaaaaaatcaag
ccaaccctcacagatttcgaaatccaactcagagatgcccaaaaggacaagtcgtctaag
ctcgcagcaaagtccaatgagcagctctgggagataatgcaactccaccaccagcgctct
agatacatatatactctgtactacaagagaaaggccatctccaaagacctttacgattgg
ttgataaaggaaaagtatgctgataaattgctaattgccaaatggcgcaaaaccgggtat
gaaaaactgtgctgtctgcgctgcattcaaaagaacgaaactaacaacggtagcacttgc
atctgcagggtgcctcgtgcacagttagaggaagaagcacgcaaaaagggcacacaggtg
tccttccatcagtgcgtccactgcggctgccgtggatgtgcaagcacagactaa

DBGET integrated database retrieval system