KEGG   Saccharomyces cerevisiae (budding yeast): YCR065W
Entry
YCR065W           CDS       T00005                                 

Gene name
HCM1
Definition
(RefSeq) Hcm1p
  KO
K09413  forkhead transcription factor HCM1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sce03000]
    YCR065W (HCM1)
Transcription factors [BR:sce03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    YCR065W (HCM1)
SSDB
Motif
Pfam: Forkhead
Other DBs
NCBI-GeneID: 850429
NCBI-ProteinID: NP_009991
SGD: S000000661
UniProt: P25364
Position
III:229310..231004
AA seq 564 aa
MMNEDISIIDGHNSFLTEKSTVLLTQAKRTLEDEKEMITPPSSTVRKTMKEVNKRPSHPL
SPDHSSPIAPSKAKRQRSDTCARSNGNLTLEEILQSLERRRINGELAKKPPYSYATLICL
AILQSQEGKLTLSQIYHWIHVHFPYYKQKDASWQNSIRHNLSLNDAFIKTEKSCDGKGHF
WEVRPGAETKFFKGENRGYEFVKDSLQDIGKYFEIDSTLDELEQVESGEGNDDLPDEEER
EEAGKFPSIEIQLNSSPILRVSQLHHIPQLKTDNSVLNPHENLESMRNMIENDVNNIDSL
EPPYVMKKYHTSLGLPSLVNAKDHFQAGVKNNNITQANRFNTLPITSAKSPQNFRKYFTS
FNSNFEDLSPLRSNVGAGSLLDPLPYSPLKLYDQKNLALMSKPQSQQSYSNSQLPPPPSS
HGSDLLKTPKMRHSDGLEKTPSRLISTPKDGNSILRKWQTPSHLFEDLYCSPLFRAIETP
IRYITTPGGTLETQISPRKSSAPDVLTSATNSKFASSGLFGVDVYSVWKRATEKISDGNN
TTDSNQKHHPYHNHPSNDSGNEKN
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgatgaatgaagacatatccatcattgatggccataatagttttttaacggaaaaaagc
accgtgctattaacccaagccaagagaacactagaagacgaaaaggaaatgattactccc
ccgagctcaactgtgagaaaaacaatgaaggaagtaaataagaggccgtcgcatcccctc
tcaccggatcactcgtccccaattgctccatctaaggccaagcgccaaagatcggacaca
tgcgctcggtccaatggtaacctaaccttggaagaaattcttcaatctttggaaagaaga
agaataaatggtgaactcgccaagaaacctccatattcgtatgcaactttgatttgcttg
gccattttgcaatctcaggagggaaagctaacgctatcccagatatatcattggatccac
gttcacttcccttattacaagcagaaagatgctagttggcaaaattcaataagacataac
ttgtctttaaatgatgcgttcatcaagactgaaaagtcctgcgatggtaagggtcatttc
tgggaggtcagaccgggtgccgaaacaaaatttttcaaaggtgaaaatcgtggttatgaa
tttgtaaaggactccttacaagacattgggaagtattttgaaatagattctacacttgat
gaattagaacaagttgagagtggagaaggcaatgatgatcttcctgacgaggaagaaaga
gaggaagcagggaaattcccttccattgaaattcaattgaactcctcccctatactgaga
gtttcccagttacatcacataccgcaattgaaaacagacaacagtgtactgaaccctcac
gaaaacctagaatcgatgcggaacatgatagaaaacgatgtcaacaatatagattccttg
gaacctccttatgtcatgaagaaatatcatacttctttaggcttaccgtcgctggtgaat
gccaaagatcatttccaggcgggtgtgaaaaacaataatatcacccaggcaaatagattt
aatacactccctataactagcgcaaagtctcctcagaatttcagaaaatatttcacctca
ttcaattcaaattttgaagatttatctccacttcgaagtaatgtaggggctggttctcta
ctcgacccacttccgtattccccattgaagctgtacgatcagaaaaatcttgcgctcatg
tcgaaaccacaatctcagcaatcatattccaattctcaacttccacctccaccttcctct
catggttcggacttacttaaaacacccaagatgaggcattccgatggcttagagaaaacc
ccatcgcggttgataagcacacctaaggacggtaactcgattttgaggaaatggcagact
ccttcacacctttttgaagatttgtactgttctccgctatttagagctatagagactcca
atcaggtatatcacgacgccggggggcactttggaaacccaaatttcaccaagaaagtcc
tctgcacccgatgtcctcacaagcgcaacgaattccaaatttgcttcaagcgggctgttt
ggcgtggatgtttattctgtttggaagcgcgcaactgaaaagatttctgatggtaacaat
actacggatagcaatcaaaaacatcatccttatcataatcacccttccaacgatagcggt
aatgaaaagaattga

DBGET integrated database retrieval system