KEGG   Saccharomyces cerevisiae (budding yeast): YCR073C
Entry
YCR073C           CDS       T00005                                 
Symbol
SSK22
Name
(RefSeq) mitogen-activated protein kinase kinase kinase SSK22
  KO
K11230  mitogen-activated protein kinase kinase kinase [EC:2.7.11.25]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YCR073C (SSK22)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sce01001]
    YCR073C (SSK22)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     YCR073C (SSK22)
Protein kinases [BR:sce01001]
 Serine/threonine kinases: STE group
  Other
   YCR073C (SSK22)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like ABC1 MEKK4_N APH
Other DBs
NCBI-GeneID: 850436
NCBI-ProteinID: NP_009998
SGD: S000000669
UniProt: P25390
Position
III:complement(242588..246583)
AA seq 1331 aa
MMMDILNTQQQKAAEGGRVLAPHTISSKLVKRLSSHSSHKLSRSDLKALGGSETISDGPS
QLTFKDRYVFNESLYLKKLKKTALDDYYTRGIKLTNRYEEDDGDDEIIRLSNGDRIDEDL
HSGVKFFSTTPYCRKMRSDSDELAWNEIATERFKWQSMLARVLKGDIVKGEKTRIANQVK
KPGLNKELSDEIWLELKAWLNGRTMQEMEQSLTYLRDSSDSVFEEIMKFQIPQGKILSLD
ALEAILQDLMNRYHSVVSYWPNLKKMYKDKPITNTAEFTARIDVMNSWLNFKTNLTLRRQ
ELDDWINRFSPISSSDNCQEDFDGVPQWNCKMKILAEQLMKEKNIESIFQKKIFYPLSPW
MFKLKLHFIVYRETLTKMNIKYPYERLRSLLAFPVYLIKEVILTRLSYARKLKNPTMMMI
DQMIDDFNAFIRLSVQLKYTLTKYCSNLPFDVDFDPTFENTVIEAIRYLFFLLNLKLIDS
SKQNFKAPDLLLKYWDHLKNTGHYINGAETVIPNEFLKLTLRLVHKLQFYLLKQQNFPPT
FANASEAEKWLSSIFENLGAMKRKLNRFSNILVKAFQNSAVYQINHNAQLVKKLKDAHYF
LVYSGNTFESSGVYMFAAPELLGCDNDTILRILRNKSIGCDLVPKLDIGNNLNVYDITTK
ETDLNILVSKGEDSKGIPYYRVVANSSSDLDRHAHQSKKKNFSTDPFDQHLDEKNNEVFE
LEVALSSLGALVVLYPGEPVVWDGPVYKLPGNNLFASNEMDLGKIGNPNTLILLNQGSNY
ALTYQIDKFNQTVGDSVSFIEKRCSLNSIESSLQKINKAYYKLTYTVLNNYKGILGSFMK
QCPGNELLNSIFMFGRDFGRSFLKYNAFSSKRKYVIIFLMVKLGMNWLKFLVEECDPTDQ
RTFRWCVLAMDFAMQMTSGYNILALNVKQFQELKERVSVCMSLLISHFDVMGARATEAEN
GMQQARLNIDTEENIDEEATLEINSRLRLEAIKTLEKTMKRNPRQMGKVLDATDQGNKYL
LSLASSLSNVSMRWQKRSFIGGGTFGQVYSAINLENGEILAVKEIKIHDTTTMKKIFPLI
KEEMTVLEMLNHPNIVQYYGVEVHRDKVNIFMEYCEGGSLASLLDHGRIEDEMVTQVYTF
ELLEGLAYLHQSGVVHRDIKPENILLDFNGIIKYVDFGTARTVVGSRTRTVRNAAVQDFG
VETKSLNEMMGTPMYMAPETISGSAVKGKLGADDVWALGCVVLEMATGRRPWSNLDNEWA
IMYHVAAGRIPQLPNRDEMTAAGRAFLERCLVQDPTMRATAVELLIDPWMIQIREIAFGN
SEKDQVPILSS
NT seq 3996 nt   +upstreamnt  +downstreamnt
atgatgatggatatactgaatacacagcaacaaaaagcggctgaaggcgggagagttctg
gctcctcataccatctcaagtaagctcgtgaagagattatcaagtcattccagccataaa
ctatcaagatctgatttgaaagcattgggtggctcggaaacaataagcgacggccccagt
cagctgacttttaaggaccgatacgttttcaatgaatcgctatacttgaaaaagctaaaa
aagaccgctttagatgactactacacgaggggcataaaactcactaaccgctacgaggaa
gacgacggtgatgacgaaattattcggttgtctaatggcgacagaattgatgaagacctg
cactcaggtgtcaagtttttctccactacaccttattgcaggaaaatgaggtcagacagt
gatgaactagcttggaatgaaattgcgaccgaacggttcaaatggcagtcaatgctggcc
agagtgctgaagggagatattgttaaaggtgaaaagacgaggattgctaaccaagtcaag
aaaccagggttaaataaggagctctcagatgagatatggctcgaattgaaggcatggctg
aatgggaggaccatgcaagagatggaacagtcgcttacatatttaagagatagttcagat
tccgtttttgaagagataatgaagtttcaaattccacagggcaagatattgagcctggat
gcactggaggccatcttacaagacctcatgaacagatatcacagcgttgtctcttattgg
cctaacttgaaaaaaatgtataaggataaaccaatcaccaatactgcagaatttaccgct
agaatagacgtaatgaattcttggctgaactttaaaacgaacttaacgttgaggaggcaa
gagttggacgactggataaaccgtttctcaccgataagtagttcggataattgccaagag
gattttgatggtgtgccccaatggaactgcaaaatgaagattcttgcagaacaattgatg
aaggaaaagaacatcgagtctatattccaaaaaaaaattttctatccgctatcaccttgg
atgttcaaactgaaactacattttatagtctacagagaaactttgacaaagatgaacata
aaatatccttatgaaaggttaagatcactactggcgttccccgtctatttaatcaaagaa
gttattttgactagattgtcatatgcacgaaagcttaaaaatccaacaatgatgatgatc
gatcaaatgatcgatgattttaacgcttttattcgactttctgtgcaattgaagtacaca
ctgacaaaatattgctccaatttgccgttcgatgtggattttgacccgacgttcgaaaat
actgtaatagaagccattcgttatttattttttctgttgaatttaaagttgattgattcc
agtaaacaaaatttcaaagcacccgatctactcttgaaatactgggatcacctaaaaaac
accggtcactatattaacggtgcagaaaccgtgattccaaatgaatttctcaagttaact
ttgagactcgtacataaattgcaattctatcttttgaaacaacaaaacttcccaccaaca
tttgctaacgcttcagaagcagaaaaatggctaagttccattttcgaaaatttgggtgcc
atgaaaagaaagctgaacaggttcagcaatattctagtcaaggcgttccaaaattctgct
gtttatcagattaatcataatgcacaacttgttaaaaagttaaaagatgctcactatttt
ttggtatactccggtaacacttttgagtctagtggtgtatatatgtttgctgctcctgaa
ttattaggttgtgacaatgataccatcttaagaattttgcgaaataaatccattggctgt
gatttggtcccaaagcttgacattggaaataatttgaatgtgtatgatataacaacaaaa
gaaacagatttgaacattctagtatcgaaaggggaggattccaaaggaattccttactac
cgagtagtagcaaattcgtcaagtgatttggacaggcatgctcatcagtccaaaaagaag
aatttttcaacagacccttttgatcagcaccttgatgaaaagaacaatgaagtttttgaa
ttggaagttgctttgagctcattgggtgcactagttgtactatatcctggagagccagta
gtttgggatggaccagtatataagcttccaggtaacaacctttttgcatccaacgaaatg
gatttagggaaaattggtaacccaaatacgttgattttactcaatcaaggttctaattat
gcactgacttatcaaatcgacaagtttaatcaaacggtaggtgattctgtttcattcata
gagaaacgttgttcactcaattcaattgaatcctccctacaaaaaatcaataaggcatat
tacaaacttacttatacagtattgaacaactacaaaggaattctaggtagctttatgaag
caatgtccgggaaatgagttgttaaattcgatattcatgtttggaagggattttggaaga
agtttccttaaatataacgcctttagctcaaagaggaagtacgttatcatctttctgatg
gttaaattaggaatgaactggttgaaattccttgttgaagagtgtgatcctaccgatcag
cgaactttccgatggtgcgttcttgcaatggattttgcgatgcagatgactagtggttat
aatatcctggcgctgaatgtaaagcaatttcaagaactgaaggagagggtatcagtatgt
atgtcattattaatttcacatttcgacgttatgggtgcacgagccactgaagctgaaaat
ggcatgcaacaggcaagattgaatattgatactgaagagaatattgatgaagaggccacc
ctagaaataaacagcaggttgagactggaagctataaagacgttggaaaagactatgaag
aggaatcccaggcaaatgggtaaggtattggatgctacagatcagggaaacaaataccta
ctatcgctagcatcctcattatcgaatgtatcaatgaggtggcaaaaaagaagcttcatt
ggcggtggaacatttggacaggtatactctgcaattaatctggaaaacggtgaaatctta
gctgttaaggaaataaagatacacgataccacaacaatgaagaagatttttcccctgatt
aaagaagagatgaccgtattggaaatgttaaaccatcctaatattgtccagtactatggt
gtcgaagtacatcgcgataaagttaacatcttcatggaatactgtgagggtggttcttta
gcctcgttattggatcatggaagaattgaagatgaaatggtaacacaagtgtacacattc
gaactattagaaggtttggcatatttgcaccaatctggcgtggtgcatcgcgacattaaa
ccggagaatatcttgctggatttcaatggaatcataaaatatgtggattttggtacggca
cgtaccgttgtaggatctaggactagaactgtgcggaacgcagccgttcaagattttgga
gtagaaacaaagtccctcaatgaaatgatggggacaccgatgtatatggctccagagact
atttcaggctcggcagttaagggaaaacttggagcggacgatgtatgggcattaggatgt
gttgtgctagaaatggccacaggtagacgaccttggtctaacttggataatgaatgggcc
atcatgtaccacgttgctgcaggtcgaataccgcaactacccaatagagacgaaatgact
gcagcgggaagagccttcttggaaaggtgtttggttcaagaccccactatgagggctact
gctgtggaactactgatagacccttggatgatacaaatccgtgaaatagcatttggcaac
tcagagaaagatcaagtacctatcctaagctcatag

DBGET integrated database retrieval system