KEGG   Saccharomyces cerevisiae (budding yeast): YCR083WHelp
Entry
YCR083W           CDS       T00005                                 

Gene name
TRX3
Definition
(RefSeq) Trx3p
  KO
K03671  thioredoxin 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sce03110]
    YCR083W (TRX3)
Chaperones and folding catalysts [BR:sce03110]
 Protein folding catalysts
  Protein disulfide isomerase
   YCR083W (TRX3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin Thioredoxin_2 Thioredoxin_8 AhpC-TSA Redoxin DSBA Phosducin Thioredoxin_9 TraF Thioredoxin_7 HyaE
Motif
Other DBs
NCBI-GeneID: 850444
NCBI-ProteinID: NP_010006
SGD: S000000679
UniProt: P25372
Structure
PDB: 

Position
III:259578..259961
Genome map
AA seq 127 aa AA seqDB search
MLFYKPVMRMAVRPLKSIRFQSSYTSITKLTNLTEFRNLIKQNDKLVIDFYATWCGPCKM
MQPHLTKLIQAYPDVRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPTAL
EKGIKDL
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgttgttctataagcctgtgatgaggatggcggtgagaccgctaaaaagcataagattc
cagtcctcatacaccagtattactaaattgacgaacctaacagaatttaggaatttgatc
aagcaaaatgataaactagtcatcgatttttatgctacttggtgtggcccctgtaagatg
atgcaaccacacttaacgaaattaattcaggcttatccagatgtaagatttgtcaagtgc
gacgtggacgaatcaccagatattgccaaagagtgtgaagtgacggctatgcccaccttt
gttcttggcaaggatggccaactcatcggcaagatcattggagctaaccctactgcttta
gagaagggaatcaaagatctataa

DBGET integrated database retrieval system