KEGG   Saccharomyces cerevisiae (budding yeast): YCR084CHelp
Entry
YCR084C           CDS       T00005                                 

Gene name
TUP1, AAR1, AER2, AMM1, CRT4, CYC9, FLK1, ROX4, SFL2, UMR7
Definition
(RefSeq) chromatin-silencing transcriptional regulator TUP1
  KO
K06666  general transcriptional corepressor TUP1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
sce04111  Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YCR084C (TUP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    YCR084C (TUP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sce03021]
    YCR084C (TUP1)
Transcription machinery [BR:sce03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     YCR084C (TUP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40 Tup_N ANAPC4_WD40 Nup160 WD40_like
Motif
Other DBs
NCBI-GeneID: 850445
NCBI-ProteinID: NP_010007
SGD: S000000680
UniProt: P16649
Structure
PDB: 

Position
III:complement(260311..262452)
Genome map
AA seq 713 aa AA seqDB search
MTASVSNTQNKLNELLDAIRQEFLQVSQEANTYRLQNQKDYDFKMNQQLAEMQQIRNTVY
ELELTHRKMKDAYEEEIKHLKLGLEQRDHQIASLTVQQQRQQQQQQQVQQHLQQQQQQLA
AASASVPVAQQPPATTSATATPAANTTTGSPSAFPVQASRPNLVGSQLPTTTLPVVSSNA
QQQLPQQQLQQQQLQQQQPPPQVSVAPLSNTAINGSPTSKETTTLPSVKAPESTLKETEP
ENNNTSKINDTGSATTATTTTATETEIKPKEEDATPASLHQDHYLVPYNQRANHSKPIPP
FLLDLDSQSVPDALKKQTNDYYILYNPALPREIDVELHKSLDHTSVVCCVKFSNDGEYLA
TGCNKTTQVYRVSDGSLVARLSDDSAANNHRNSITENNTTTSTDNNTMTTTTTTTITTTA
MTSAAELAKDVENLNTSSSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMI
LQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGK
YIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSV
KLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKK
SGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWKYKKIAPN
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgactgccagcgtttcgaatacgcagaataagctgaatgagcttctcgatgccatcaga
caggagtttctccaagtctcacaagaggcaaatacctaccgtcttcaaaaccaaaaggat
tacgatttcaaaatgaaccagcagctggctgagatgcagcagataagaaacaccgtctac
gaactggaactaactcacaggaaaatgaaggacgcgtacgaagaagagatcaagcacttg
aaactagggctggagcaaagagaccatcaaattgcatctttgaccgtccagcaacagcgg
caacagcaacagcagcaacaggtccagcagcatttacaacagcaacagcagcagctagcc
gctgcatctgcatctgttccagttgcgcaacaaccaccggctactacttcggccaccgcc
actccagcagcaaacacaactactggttcgccatcggccttcccagtacaagctagccgt
cctaatctggttggctcacagttgcctaccaccactttgcctgtggtgtcctcaaacgcc
caacaacaactaccacaacagcaactgcaacagcagcaacttcaacaacagcaaccacct
ccccaggtttccgtggcaccattgagtaacacagccatcaacggatctcctacttctaaa
gagaccactactttaccctctgtcaaggcacctgaatctacgttgaaagaaactgaaccg
gaaaataataatacctcgaagataaatgacaccggatccgccaccacggccaccactacc
accgcaactgaaactgaaatcaaacctaaggaggaagacgccaccccggctagtttgcac
caggatcactacttagtcccttataatcaaagagcaaaccactctaaacctatcccacct
ttccttttggatctagattcccagtctgttcccgatgctctgaagaagcaaacaaatgat
tattatattttatacaacccggcactaccaagagaaattgacgttgagttacacaaatct
ttggatcatacttcagttgtttgttgcgtgaagttcagtaacgatggtgaatacttagcc
acaggctgcaacaaaactactcaagtgtatcgcgtttcagatggttctctggtggcccgt
ctatctgacgattctgctgccaataaccatcgaaattcgatcactgaaaataacaccacc
acgtccacggataacaatacaatgacaaccactactaccaccacaattactaccacagcg
atgacttcggcagcagaattggcaaaagatgtggaaaacctgaacacttcgtcttcccca
tcatccgacttgtatatccgttcagtgtgtttttctccagatgggaaatttttggcaaca
ggtgctgaagacagactgattagaatttgggatattgaaaatagaaagattgttatgatt
cttcaaggccacgaacaagatatttattcattggactactttccctcaggtgacaaatta
gtctccggttctggtgaccgtaccgttcgtatttgggacttacgtacaggccagtgttca
ttgactttatccattgaagatggtgttaccaccgtcgctgtatcaccaggtgatggtaaa
tacatcgctgctggttctctagatcgtgctgtgagagtttgggattccgagaccggattc
ttggtggaaagactagattcggaaaacgaatccggtacaggccacaaggactctgtttat
agcgttgtcttcactagagatggacaaagcgttgtatccggctcattagatagatctgtt
aagctctggaatttgcagaatgcaaacaacaagagcgattcgaaaactccaaattccggc
acttgtgaagttacgtatatcgggcataaagactttgtattgtccgtggccaccacacaa
aatgatgagtacatcttgtccggttccaaagatcgtggtgtcctgttttgggataagaaa
tccggcaatccgttattgatgttgcaaggtcataggaattcagttatatctgtggctgtg
gcaaacgggtctccgctgggtccagaatataacgtttttgctactggtagcggtgattgt
aaagcaaggatttggaagtataaaaaaatagcgccaaattaa

DBGET integrated database retrieval system