KEGG   Saccharomyces cerevisiae (budding yeast): YCR086WHelp
Entry
YCR086W           CDS       T00005                                 

Gene name
CSM1
Definition
(RefSeq) Csm1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Csm1_N Csm1 FlxA BRE1 Spc24 DUF4407 DUF4618 Phage_GP20 TMF_DNA_bd Fib_alpha DUF3138 DASH_Dad2 DUF16 SlyX TolA_bind_tri DUF3450 Seryl_tRNA_N Cauli_AT BLOC1_2 DUF4795 DivIC LPP DUF4559 CENP-H
Motif
Other DBs
NCBI-GeneID: 850447
NCBI-ProteinID: NP_010009
SGD: S000000682
UniProt: P25651
Structure
PDB: 

Position
III:263392..263964
Genome map
AA seq 190 aa AA seqDB search
MDPLTVYKNSVKQQIDSADLLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKEL
KTQTSQQAENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTHSGGSSDDYSIMDYKL
GFVKGQAQVTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSLN
KKREKKDETE
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggatccattgactgtatacaaaaactcagtgaaacaacagatcgattccgcagactta
ctagtggcaaatttggtaaatgagaatttcgtactgtcggagaagctggatacaaaagca
accgagatcaaacagctgcagaagcagatagactcgctaaacgcacaagtcaaggagctg
aagactcagacttcccaacaggcagaaaattcagaagtcataaaggacctttacgagtac
ctctgtaacgtacgtgtacataaaagctacgaggatgattctgggttgtggttcgacatc
tcgcagggcacccactcagggggatcttccgatgattattcgataatggactataaactc
ggatttgtcaagggccaggcccaagtcacagaagtcatatatgcgcccgttcttaaacag
cgatccaccgaggaactatactcgctacagtcgaaactaccggaatacctcttcgaaacg
ttgagtttccccctctcgtcgctaaaccaattctataacaaaatcgctaaaagcctgaat
aagaaaagagagaaaaaagatgaaaccgagtaa

DBGET integrated database retrieval system