KEGG   Saccharomyces cerevisiae (budding yeast): YCR088WHelp
Entry
YCR088W           CDS       T00005                                 

Gene name
ABP1
Definition
(RefSeq) Abp1p
  KO
K20520  drebrin-like protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YCR088W (ABP1)
Membrane trafficking [BR:sce04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    YCR088W (ABP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cofilin_ADF SH3_1 SH3_9 SH3_2
Motif
Other DBs
NCBI-GeneID: 850450
NCBI-ProteinID: NP_010012
SGD: S000000684
UniProt: P15891
Structure
PDB: 

Position
III:265068..266846
Genome map
AA seq 592 aa AA seqDB search
MALEPIDYTTHSREIDAEYLKIVRGSDPDTTWLIISPNAKKEYEPESTGSSFHDFLQLFD
ETKVQYGLARVSPPGSDVEKIIIIGWCPDSAPLKTRASFAANFAAVANNLFKGYHVQVTA
RDEDDLDENELLMKISNAAGARYSIQTSSKQQGKASTPPVKKSFTPSKSPAPVSKKEPVK
TPSPAPAAKISSRVNDNNDDDDWNEPELKERDFDQAPLKPNQSSYKPIGKIDLQKVIAEE
KAKEDPRLVQKPTAAGSKIDPSSDIANLKNESKLKRDSEFNSFLGTTKPPSMTESSLKND
DDKVIKGFRNEKSPAQLWAERKAKQNSGNAETKAEAPKPEVPEDEPEGEPDVKDLKSKFE
GLAASEKEEEEMENKFAPPPKKSEPTIISPKPFSKPQEPVKAEEAEQPKTDYKKIGNPLP
GMHIEADNEEEPEENDDDWDDDEDEAAQPPLPSRNVASGAPVQKEEPEQEEIAPSLPSRN
SIPAPKQEEAPEQAPEEEIEEEAEEAAPQLPSRSSAAPPPPPRRATPEKKPKENPWATAE
YDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYVSLGN
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggctttggaacctattgattatactactcactcgagagagatcgacgcagagtacctg
aagattgtcagaggctccgatcctgacaccacctggttgattatttcacccaatgcgaaa
aaagaatacgaacctgagtctaccggttcctcctttcacgatttcttgcaattgtttgat
gaaaccaaggtccagtacggactggcacgtgtgtccccaccagggtcagacgttgagaag
attattatcattggttggtgtcctgattctgcgccattgaagacaagggcctctttcgcc
gccaattttgctgcagttgctaataatctgttcaagggttaccacgttcaagttaccgcc
agagacgaggacgatcttgacgaaaatgaactgttgatgaaaatcagtaacgcggccggt
gcccgttattctattcagacttcctccaagcaacaggggaaggcttccactcctcccgtg
aagaaatccttcacaccttccaagagccctgctccagtttctaagaaggaaccagtcaag
actccttccccagcacctgctgctaagatttcttcccgtgttaacgacaacaatgacgac
gacgattggaatgagcctgaattaaaggaacgcgacttcgatcaggctcccctgaaacca
aatcaatcatcttacaaaccaattggcaaaatcgacttgcaaaaagtgattgctgaagaa
aaggctaaggaggacccacgtcttgttcaaaagccaaccgctgctggttccaagattgat
cctagttctgatatcgctaatttaaagaacgaatcaaaattaaagagggactccgagttt
aactcctttttgggcaccactaaacccccctccatgacggaatcttcattaaagaatgat
gatgataaagtcattaagggttttagaaacgagaaatcacctgctcaattatgggccgaa
agaaaggcaaagcaaaacagcggcaacgccgaaactaaggctgaggcaccaaaacctgaa
gttccagaagatgagcctgaaggtgaacctgacgtcaaagatttgaaatcaaaatttgaa
ggattggccgcttcagaaaaagaggaggaagaaatggaaaacaaatttgctcctcctcca
aagaaatcagaaccaactattatctcaccaaaacccttctccaagccacaagaacctgtg
aaagctgaagaagccgagcagcctaagactgattacaagaagatcggcaacccattaccc
ggtatgcacattgaagcggataatgaggaagaaccagaagagaatgatgatgactgggat
gatgatgaagacgaggctgctcaacctcctttgccttcgaggaatgttgcgtcaggagca
ccagtgcaaaaagaagagcctgaacaagaagagatcgccccaagcttaccttctagaaac
tcgatcccagctccaaaacaagaagaagcacctgaacaagcacctgaagaagaaattgaa
gaagaagctgaggaagccgctccacagctgccatcaagaagctctgcagctcctcctccg
cctccaagacgagcaactccagagaaaaagccaaaggaaaatccttgggccacagcagaa
tatgattacgatgctgcagaagataacgaactgacctttgtggaaaatgacaagattatc
aatattgaatttgtcgacgatgactggtggctaggggaactagagaaagacggctcaaaa
ggtctcttccccagcaattatgtgtctttgggcaactag

DBGET integrated database retrieval system