KEGG   Saccharomyces cerevisiae (budding yeast): YCR090CHelp
Entry
YCR090C           CDS       T00005                                 

Definition
(RefSeq) hypothetical protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF866 zf-FLZ
Motif
Other DBs
NCBI-GeneID: 850452
NCBI-ProteinID: NP_010014
SGD: S000000686
UniProt: P25654
Position
III:complement(272315..272863)
Genome map
AA seq 182 aa AA seqDB search
MPLFLVLKATLSENVTKVSIENTNESRAEFAFDLQCTSCRELHDSKVIINTFEEYAMPAS
KGTASFLMKCKFCSKELSVNLCAFEDEYLTDQSDDKWAKIKDVRKKHGLSKVKEDSFIPL
SLDCRGCELIKFYPDTITFEVSLSSGKVMSCQLEDNEWYDYDDNLGEEVTMTDFSSSIIK
GK
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgccgttatttttggttctgaaagcaacattatcagaaaacgtgaccaaggtttcaatt
gagaatacaaacgaatcaagggcagaatttgccttcgatctacaatgtaccagttgtaga
gaattacacgattctaaagtcatcatcaatacatttgaagaatatgctatgccggcatca
aaaggtaccgcatctttcttgatgaagtgtaaattttgttcaaaagaattgtcagttaac
ctgtgcgcttttgaggatgaatatttaactgatcagagtgacgacaaatgggccaagata
aaagatgtgcggaagaagcatggtttatcgaaggtcaaagaagattctttcattccttta
agccttgattgcagaggttgtgaattaatcaaattttatcccgacaccataacgtttgaa
gtttctctaagttcggggaaagtaatgtcatgccaactagaggataatgaatggtatgat
tatgatgacaaccttggggaagaagtaacaatgactgatttctcatcaagcattattaaa
ggtaagtaa

DBGET integrated database retrieval system