KEGG   Saccharomyces cerevisiae (budding yeast): YCR098C
Entry
YCR098C           CDS       T00005                                 

Symbol
GIT1
Name
(RefSeq) Git1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: Sugar_tr MFS_1 DMT_YdcZ BT1
Other DBs
NCBI-GeneID: 850462
NCBI-ProteinID: NP_010022
SGD: S000000695
UniProt: P25346
Position
III:complement(297049..298605)
AA seq 518 aa
MEDKDITSVNEKEVNENTNPRIIKYDAERRATRTETSKKDKWKNIVTIIASGFALISDGY
VNGSMSMLNKVFVMEYGKKNYSSKVSTRVSNAALVGIIFGQFFMGIAADYYSRKSCILVA
TAILVIGSALCAASHGTTVPGMFWMLTVMRGLVGIGVGAEYPTSTLSANESANEYTTTKR
GGILVMVTNLPLAFGGPFATIIFLIVYKICSGTKHLEAIWRTVFAIGCFWPLSVFYFRWK
TATTEVYEKGRIKRNIPYFLALKFYWKRLLGTCGTWFMYDFVTFPNGIFSSTIISSVIKD
QNDLVKVAEWNLLLGVLAVLGVPIGAYLSDRIGRKYTLMFGFSGYIIFGLIIGCAYDQLK
KITPLFIIFYAFMNMLGNAGPGDMLGVISSEASATAVRGVFYGLSAVTGKIGSVVGVECF
QPIRDNLGARWTFIIAAICGLIGIIITYFFVPHSLESDLMKQDVEFHNYLVSNGWTGKMG
FDETDEESMVRTIEVEENGTNCSKKNAEIISVRQVDQS
NT seq 1557 nt   +upstreamnt  +downstreamnt
atggaagacaaagatatcacatcggtaaatgagaaggaagtgaacgagaacactaatcct
agaataataaaatatgatgccgagaggcgtgcaacccgtactgaaacctcaaagaaagat
aaatggaaaaacatagttacaatcattgcgtccggttttgctctgataagtgatggttac
gtaaatggttcaatgagtatgctaaacaaggtttttgttatggagtacggtaagaaaaac
tatagctcaaaagtgtcgactagagtttccaacgcagccctagttggtattatttttggc
caattctttatgggtatcgctgctgattattatagtagaaaatcttgtatccttgtggcc
actgctatcttggttattggtagtgctctgtgtgctgcctctcacggtactactgtacct
ggcatgttttggatgttaacagttatgagaggtttggtaggtattggtgttggtgcagaa
tatcctaccagtacattaagtgctaatgagtctgctaatgaatataccactaccaaaaga
ggtggtatcctggttatggtgacaaatttgccactagccttcggtggtccatttgctacg
atcatctttttaatcgtctacaaaatctgttcaggaacaaaacatttagaggcgatctgg
aggactgtttttgcaatagggtgcttctggccattgagtgtgttctattttagatggaag
actgctactacagaagtctatgaaaaaggtagaatcaagagaaatataccatatttccta
gcattgaaattttattggaaaaggttacttggtacatgtggtacatggtttatgtatgat
tttgttaccttcccaaatggtattttcagttcaacaattatcagttccgttatcaaggac
caaaatgatttagtaaaagtggcagagtggaacttactgttgggagttttagctgtactg
ggtgtaccaattggtgcttatctgtccgatcgtattggtcgtaaatatacgttgatgttt
ggtttctctgggtacatcatctttggtctaatcattggatgtgcgtacgaccaattgaaa
aaaatcacccccttgtttattatcttctacgcattcatgaatatgttaggtaatgctgga
ccaggtgatatgcttggtgttattagtagtgaagcgtcagcaaccgctgttagaggtgtt
ttctatggtttatctgctgtgactggtaaaatcggttctgtagtaggcgtcgaatgtttc
caacccattagggataatttgggtgcaagatggacttttattattgctgcaatttgtggt
cttattggtatcattattacatatttctttgttccacattctcttgaaagcgatttaatg
aagcaagacgttgaatttcacaactatttggtatccaatggctggactggtaagatggga
tttgatgagacagatgaagaatcaatggttagaactattgaagttgaagagaatggtact
aattgtagtaagaaaaacgcagaaataatttcagtcagacaggtcgatcaaagttga

DBGET integrated database retrieval system