KEGG   Saccharomyces cerevisiae (budding yeast): YDL006WHelp
Entry
YDL006W           CDS       T00005                                 

Gene name
PTC1, CWH47, KCS2, TPD1
Definition
(RefSeq) type 2C protein phosphatase PTC1
  KO
K19704  protein phosphatase PTC1 [EC:3.1.3.16]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04011  MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:sce00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    YDL006W (PTC1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sce01009]
    YDL006W (PTC1)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     YDL006W (PTC1)
Protein phosphatases and associated proteins [BR:sce01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    YDL006W (PTC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP2C
Motif
Other DBs
NCBI-GeneID: 851558
NCBI-ProteinID: NP_010278
SGD: S000002164
UniProt: P35182
Position
IV:439909..440754
Genome map
AA seq 281 aa AA seqDB search
MSNHSEILERPETPYDITYRVGVAENKNSKFRRTMEDVHTYVKNFASRLDWGYFAVFDGH
AGIQASKWCGKHLHTIIEQNILADETRDVRDVLNDSFLAIDEEINTKLVGNSGCTAAVCV
LRWELPDSVSDDSMDLAQHQRKLYTANVGDSRIVLFRNGNSIRLTYDHKASDTLEMQRVE
QAGGLIMKSRVNGMLAVTRSLGDKFFDSLVVGSPFTTSVEITSEDKFLILACDGLWDVID
DQDACELIKDITEPNEAAKVLVRYALENGTTDNVTVMVVFL
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatcattctgaaatcttagaaaggccagaaacaccatatgacataacttataga
gtaggtgtggcggaaaataaaaactcgaaatttcggaggacaatggaagatgttcatacg
tatgttaaaaactttgcttcaagattagattggggatatttcgcggtgtttgatggacat
gctgggattcaggcctccaaatggtgtggtaaacatcttcatacaattatagagcaaaac
attttggcagatgaaacacgagatgttagagatgtattgaacgattcattcctagccatt
gacgaagaaattaatacaaaacttgtaggaaatagtggatgtactgctgctgtttgcgta
ttacgttgggagcttccggattcagtttctgatgattcaatggatttagcccaacaccaa
agaaagttatatacagcaaatgttggtgattctcgaatagtattgtttagaaacgggaac
agcataagactgacttatgatcataaggcatctgacactttggagatgcagagagttgaa
caagcaggtggcctgataatgaaaagtcgtgtaaatggtatgctggcagtgacgagatcg
ttaggggataaattttttgatagtttagtagtgggcagcccatttaccacgagcgtagaa
ataacttctgaggacaaatttttaatcctagcgtgtgatggattatgggatgttattgat
gatcaagatgcatgcgaattaatcaaggatattactgaacctaatgaagctgcaaaagtc
ttggttagatatgctttggaaaatggcacaacagataatgtaacggtcatggttgtcttc
ctctaa

DBGET integrated database retrieval system