KEGG   Saccharomyces cerevisiae (budding yeast): YDL029W
Entry
YDL029W           CDS       T00005                                 

Gene name
ARP2, ACT2
Definition
(RefSeq) actin-related protein 2
  KO
K17260  actin-related protein 2
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04138  Autophagy - yeast
sce04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    YDL029W (ARP2)
   04138 Autophagy - yeast
    YDL029W (ARP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YDL029W (ARP2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sce04812]
    YDL029W (ARP2)
   04147 Exosome [BR:sce04147]
    YDL029W (ARP2)
Membrane trafficking [BR:sce04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    YDL029W (ARP2)
Cytoskeleton proteins [BR:sce04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     YDL029W (ARP2)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YDL029W (ARP2)
  Exosomal proteins of other body fluids (saliva and urine)
   YDL029W (ARP2)
  Exosomal proteins of bladder cancer cells
   YDL029W (ARP2)
SSDB
Motif
Pfam: Actin MreB_Mbl
Other DBs
NCBI-GeneID: 851532
NCBI-ProteinID: NP_010255
SGD: S000002187
UniProt: P32381
Position
IV:join(399340..399361,399485..400638)
AA seq 391 aa
MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEA
SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE
KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRR
LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV
ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI
VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL
ASIMADKDHMWLSKQEWQESGPSAMTKFGPR
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggacccacataatccaattgtccttgatcagggtactggtttcgtcaaaattggtcgt
gctggcgagaatttcccagattacacgtttccttctattgttggtagacccatcttgagg
gcggaagaacgtgccagcgttgctacaccattaaaggacattatgattggtgatgaggca
agtgaagttcgctcttatctgcaaatatcttatcctatggaaaacggtattattaagaat
tggacagatatggaacttctttgggattacgcctttttcgagcaaatgaaactaccatcc
acctccaacggtaagattttactaacggaacctccaatgaatccgctgaaaaatagggaa
aaaatgtgtgaggtaatgttcgaaaaatacgattttggcggagtttatgttgccatccaa
gctgttctagcattgtacgcacaaggtttgtcttcaggagtcgtcgtcgattccggtgac
ggtgttactcatatagtcccagtttacgaatctgtcgttttgagccacttaacaagaaga
ttagatgttgcgggtagagacgttactaggcatttgattgatctgctttctcgtcgtggt
tatgcatttaacagaactgcagatttcgaaactgtgcgtcagataaaggaaaaattatgt
tatgtttcatatgatttagacctagatacaaaattggctagagaaacaaccgcccttgtg
gaatcgtatgagttaccagatggcaggacaatcaaagtgggacaagagagatttgaagca
ccagaatgtttgttccaacctggtttggttgacgttgaacaacctggcgtgggcgagctg
ttatttaatactgtgcaatcggctgatgttgatatcagaagttccctgtataaggccatt
gttctttcaggtggttcaagtatgtacccagggctgccttcgagattagagaaagaattg
aaacaattatggtttagtagagttttacacaatgacccttcaagacttgataaattcaaa
gttagaattgaagatcctccaaggagaaagcatatggttttcattggtggtgccgtttta
gctagtatcatggctgataaagaccacatgtggttgtctaagcaagaatggcaagaaagc
gggccatctgcaatgactaaatttggtccaagatag

DBGET integrated database retrieval system