KEGG   Saccharomyces cerevisiae (budding yeast): YDL051WHelp
Entry
YDL051W           CDS       T00005                                 

Gene name
LHP1, LAH1, YLA1
Definition
(RefSeq) Lhp1p
  KO
K11090  lupus La protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: La RRM_1 PikAIV_N
Motif
Other DBs
NCBI-GeneID: 851509
NCBI-ProteinID: NP_010232
SGD: S000002209
UniProt: P33399
Position
IV:363952..364779
Genome map
AA seq 275 aa AA seqDB search
MSEKPQQEEQEKPQSRRNSFAVIEFTPEVLDRCLKQVEFYFSEFNFPYDRFLRTTAEKND
GWVPISTIATFNRMKKYRPVDKVIEALRSSEILEVSADGENVKRRVPLDLTAARNARIEQ
NQRTLAVMNFPHEDVEASQIPELQENLEAFFKKLGEINQVRLRRDHRNKKFNGTVLVEFK
TIPECEAFLKSYSNDDESNEILSYEGKKLSVLTKKQFDLQREASKSKNFSGRSRSFNGHK
KKNLPKFPKNKKKNGKEESKEDSSAIADDDEEHKE
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaaaccacaacaagaggagcaagagaaaccacaatcaagacgtaattcattt
gctgtgattgaatttactccagaagtcttggacagatgtttaaagcaagtggaattctac
ttttctgaattcaactttccatatgacaggttcttgcgcacaacagcggaaaaaaacgat
ggatgggtccccatcagcaccatcgccacattcaaccgtatgaagaaatatagaccagtg
gataaggttatcgaagcactacgtagttctgaaattttggaagtatctgctgatggagag
aacgtcaagagacgtgttcctttggacctaactgctgccagaaatgccagaattgagcaa
aaccaacggactttggctgtaatgaatttcccacatgaggacgttgaagcttcccaaatt
cctgaattgcaggagaacttggaagcctttttcaaaaaattaggtgaaatcaaccaagtg
cgtttgagaagagatcacagaaacaagaaatttaatggtacggtcttggtggaatttaag
acaattccagaatgtgaagcttttttgaaatcgtattccaatgacgatgagtccaacgaa
attttgtcatatgaaggtaagaaactgagtgttttgacgaaaaaacagtttgatttacag
agagaggcctcgaagtccaaaaacttcagcggtagatcaagatcctttaacggccataag
aagaaaaacttgcctaaattccccaaaaataagaagaaaaacggcaaggaagagtcaaaa
gaggactcttctgccattgccgatgacgatgaggagcacaaggagtga

DBGET integrated database retrieval system