KEGG   Saccharomyces cerevisiae (budding yeast): YDL052CHelp
Entry
YDL052C           CDS       T00005                                 

Gene name
SLC1
Definition
(RefSeq) 1-acylglycerol-3-phosphate O-acyltransferase SLC1
  KO
K13509  lysophosphatidate acyltransferase [EC:2.3.1.51]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00561  Glycerolipid metabolism
sce00564  Glycerophospholipid metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    YDL052C (SLC1)
   00564 Glycerophospholipid metabolism
    YDL052C (SLC1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sce01004]
    YDL052C (SLC1)
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     YDL052C (SLC1)
Lipid biosynthesis proteins [BR:sce01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   YDL052C (SLC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyltransferase
Motif
Other DBs
NCBI-GeneID: 851508
NCBI-ProteinID: NP_010231
SGD: S000002210
UniProt: P33333
Position
IV:complement(362672..363583)
Genome map
AA seq 303 aa AA seqDB search
MSVIGRFLYYLRSVLVVLALAGCGFYGVIASILCTLIGKQHLAQWITARCFYHVMKLMLG
LDVKVVGEENLAKKPYIMIANHQSTLDIFMLGRIFPPGCTVTAKKSLKYVPFLGWFMALS
GTYFLDRSKRQEAIDTLNKGLENVKKNKRALWVFPEGTRSYTSELTMLPFKKGAFHLAQQ
GKIPIVPVVVSNTSTLVSPKYGVFNRGCMIVRILKPISTENLTKDKIGEFAEKVRDQMVD
TLKEIGYSPAINDTTLPPQAIEYAALQHDKKVNKKIKNEPVPSVSISNDVNTHNEGSSVK
KMH
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgataggtaggttcttgtattacttgaggtccgtgttggtcgtactggcgctt
gcaggctgtggcttttacggtgtaatcgcctctatcctttgcacgttaatcggtaagcaa
catttggctcagtggattactgcgcgttgtttttaccatgtcatgaaattgatgcttggc
cttgacgtcaaggtcgttggcgaggagaatttggccaagaagccatatattatgattgcc
aatcaccaatccaccttggatatcttcatgttaggtaggattttcccccctggttgcaca
gttactgccaagaagtctttgaaatacgtcccctttctgggttggttcatggctttgagt
ggtacatatttcttagacagatctaaaaggcaagaagccattgacaccttgaataaaggt
ttagaaaatgttaagaaaaacaagcgtgctctatgggtttttcctgagggtaccaggtct
tacacgagtgagctgacaatgttgcctttcaagaagggtgctttccatttggcacaacag
ggtaagatccccattgttccagtggttgtttccaataccagtactttagtaagtcctaaa
tatggggtcttcaacagaggctgtatgattgttagaattttaaaacctatttcaaccgag
aacttaacaaaggacaaaattggtgaatttgctgaaaaagttagagatcaaatggttgac
actttgaaggagattggctactctcccgccatcaacgatacaaccctcccaccacaagct
attgagtatgccgctcttcaacatgacaagaaagtgaacaagaaaatcaagaatgagcct
gtgccttctgtcagcattagcaacgatgtcaatacccataacgaaggttcatctgtaaaa
aagatgcattaa

DBGET integrated database retrieval system