KEGG   Saccharomyces cerevisiae (budding yeast): YDL053CHelp
Entry
YDL053C           CDS       T00005                                 

Gene name
PBP4
Definition
(RefSeq) Pbp4p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DivIVA vMSA
Motif
Other DBs
NCBI-GeneID: 851507
NCBI-ProteinID: NP_010230
SGD: S000002211
UniProt: Q07362
Position
IV:complement(361699..362256)
Genome map
AA seq 185 aa AA seqDB search
MTTTSTTSVDGRTSSTLKATLSASGPNSNGPTPAVLPQKPKLTGWAQAAAKALPRQQQQQ
QQARKDDSVAVQPANTKTKTIASTAPPANIKGSSTANGSSTNKKFKRANKQPYNREEVRS
YMHKLFQSYTAGEKSHSMKTYKQVLSETASGRVSTATDWGTVSSSKNKNKKYGCLSDIAK
VLRNQ
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaacctcaacaaccagtgtagatggcagaacctcctcgactttgaaggctact
ttatctgcttcaggtccaaattcaaatggtccaacgcccgctgtgcttcctcagaagcca
aaattaacaggttgggcgcaggcagctgccaaagcccttccaaggcaacagcaacagcaa
cagcaggcacgaaaagatgattccgtggctgtacaacctgctaatacgaagactaaaacc
atcgcatctaccgcgccgcctgctaatataaagggtagttccaccgccaatggatcatcc
acaaataagaaatttaaaagagcgaataaacaaccttacaatagagaagaagttagatcg
tatatgcacaaattatttcagagctataccgctggtgaaaaaagtcattcaatgaaaact
tataagcaagtactatcagaaacggcaagtggcagagtttcaacagccactgactggggt
actgtatcaagcagtaaaaataagaataaaaaatacggctgtttgtccgatattgctaaa
gttttaagaaaccaatga

DBGET integrated database retrieval system