KEGG   Saccharomyces cerevisiae (budding yeast): YDL054C
Entry
YDL054C           CDS       T00005                                 

Symbol
MCH1
Name
(RefSeq) Mch1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 851506
NCBI-ProteinID: NP_010229
SGD: S000002212
UniProt: Q07376
Position
IV:complement(359825..361285)
AA seq 486 aa
MPLSKVEHYLSYHTRLLLPHVLSLQSSHRVAYIFSLLSAVSTGFITLISLYSQPWQKHLN
YSSWQINTIASMTNLGMYLTPPILGMIADSHGPITLSLLAIIGFIPSYSYLAYVFNHPEL
SLGGNGDSSFNLSIICFVFIGISTSALYFSALLTCTKLYPHTKLLSISLPTTCYGISSVV
GSQLLRIKWFWSSNASSSSSNSDLNLGRVFQTFALVYVVIGLLAWIATSVVSLLHFNEEQ
DNQKRLDDQTDVEQSPLLERSNHVQEKFTQTMLRIFSDPVTYILAVSILLSLGPLEMFIA
NMGSLTNLLVQLDAPTLSTKLLSTYALSSTFTRLLTGIVADFFAKKKISIKWILLTFLSL
GVCAQLFLLKMTSSASPWGLVPTGSLVGIVYGGLFTVYPTLVLLVWGERSFGTVYGSLLI
APAIGSMIFCMLYAKFYDSRCMSGGGDLRNPSCISAVYKYSSIAFVVSAVLSAVVFWKLK
SRKLRI
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgcctctatcaaaggtggagcactacctttcataccatacgcgcttactcttaccccat
gttttgtctcttcagtcatcacatcgtgttgcatacatcttttcgctattatctgcggtg
tcaactggcttcattactttgatatctctttactctcaaccgtggcagaaacatttaaat
tattcctcatggcaaatcaacaccatcgctagtatgactaatttggggatgtacttgacg
ccaccaatcttggggatgatcgctgattctcatggccccattactttaagtcttttagcc
atcatagggttcatacctagctattcatatctggcttacgtttttaatcatccggagtta
tctctcggaggaaatggtgactcatcattcaatctatccatcatttgtttcgttttcata
ggtatatcaacaagcgctttatactttagcgctttactgacatgcactaagctatatcct
catacaaaactactatccattagcttaccaacgacatgttatggtatttcttctgtagtc
ggttctcaactgctaagaatcaaatggttctggtcctctaacgcaagttcttcctcgtcc
aatagtgacttaaacctgggaagagtattccaaacatttgccctcgtttatgtcgttatt
gggctacttgcatggatagccaccagcgtggtatcacttttgcattttaatgaagagcaa
gacaaccaaaaacggctggatgatcaaactgatgtggaacaatcaccgctgttagaacga
agtaatcatgttcaagaaaagtttacgcagacgatgctaaggatctttagtgatcctgtg
acatatatcctagcggtatcaattttgttatcacttgggcccctcgagatgtttattgcc
aatatgggatcactgactaacctgctagtccaattagatgcgccaaccttatctacaaag
ttgttatccacatacgcgctatcttccacttttacgagattgctcacaggcatagtggca
gacttcttcgccaagaaaaaaatatcaattaaatggatcctgttgactttcctttcatta
ggggtatgtgcacaactgtttttattgaaaatgacctcttcagcgtcaccctgggggcta
gtacctacaggatcattggttggaattgtatacggtggacttttcactgtttatccgacg
ctggtcctgttagtatggggcgaacgctcattcgggactgtttacggtagcttactaatt
gcacctgctataggttctatgatattttgcatgttgtatgccaaattttacgattctcgc
tgtatgagtggcggaggagatctgcgaaatccgtcctgtatttcggctgtctacaagtac
agcagtatcgcattcgttgtatccgctgttctttcagctgtagtattttggaaattaaaa
agtagaaaactcagaatttaa

DBGET integrated database retrieval system