KEGG   Saccharomyces cerevisiae (budding yeast): YDL055CHelp
Entry
YDL055C           CDS       T00005                                 

Gene name
PSA1, MPG1, SRB1, VIG9
Definition
(RefSeq) mannose-1-phosphate guanylyltransferase
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00051  Fructose and mannose metabolism
sce00520  Amino sugar and nucleotide sugar metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    YDL055C (PSA1)
   00520 Amino sugar and nucleotide sugar metabolism
    YDL055C (PSA1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     YDL055C (PSA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep Hexapep_2 Fucokinase DUF4954 CTP_transf_3
Motif
Other DBs
NCBI-GeneID: 851504
NCBI-ProteinID: NP_010228
SGD: S000002213
UniProt: P41940
Position
IV:complement(355674..356759)
Genome map
AA seq 361 aa AA seqDB search
MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALANAGVTDIVLAVNYRPEVM
VETLKKYEKEYGVNITFSVETEPLGTAGPLKLAEDVLKKDNSPFFVLNSDVICEYPFKEL
ADFHKAHGGKGTIVATKVDEPSKYGVIVHDIATPNLIDRFVEKPKEFVGNRINAGLYILN
PEVIDLIEMKPTSIEKETFPILVEEKQLYSFDLEGFWMDVGQPKDFLSGTVLYLNSLAKR
QPKKLATGANIVGNALIDPTAKISSTAKIGPDVVIGPNVTIGDGVRITRSVVLCNSTIKN
HSLVKSTIVGWNSTVGQWCRLEGVTVLGDDVEVKDEIYINGGKVLPHKSISDNVPKEAII
M
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtttaattttagtcggtggttacggtaccagattgagacctttaactttgacc
gttccaaagccactggttgaattcggtaatagaccaatgattttacaccaaatcgaggct
ttagccaacgctggtgttactgacatcgttcttgctgttaattacagaccagaagtcatg
gtggaaactttgaagaagtacgaaaaggaatatggtgttaacatcactttctctgtagaa
actgaaccattaggtactgcaggtccattgaaattggctgaagatgttttgaagaaggac
aactctccatttttcgtcctaaactccgacgtcatttgcgaatatccattcaaggaattg
gctgacttccacaaagctcacggtggtaaaggtaccattgttgctaccaaggtcgacgaa
ccttctaaatacggtgtcattgtccatgatatagctactccaaacttgattgacagattt
gttgaaaagccaaaggaatttgttggtaacagaattaacgccggtttgtacattttaaac
ccagaagtcattgacttgattgaaatgaagccaacttcaattgaaaaggaaactttccca
atcttggtcgaagaaaaacaactatattccttcgatttggaaggtttctggatggatgtt
ggtcaaccaaaggacttcttgtctggtaccgttctttacttgaactctttggccaagaga
caaccaaaaaaattggctacaggtgccaacattgttggtaatgccttgatcgacccaacc
gctaagatttcctccactgctaagattggcccagacgtggttatcggtcctaatgtcacc
atcggtgatggtgttagaatcaccagatctgttgttttgtgcaactccaccatcaagaac
cactccttggtcaaatctaccatcgtaggctggaactctaccgttggtcaatggtgtcgt
ttggaaggtgtcactgtcttgggtgacgacgttgaagttaaggacgaaatctacatcaac
ggtggtaaagtcttacctcataagtctatctccgataatgttccaaaggaagctattatt
atgtga

DBGET integrated database retrieval system