KEGG   Saccharomyces cerevisiae (budding yeast): YDL058WHelp
Entry
YDL058W           CDS       T00005                                 

Gene name
USO1, INT1
Definition
(RefSeq) Uso1p
  KO
K20361  intracellular protein transport protein USO1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YDL058W (USO1)
Membrane trafficking [BR:sce04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    YDL058W (USO1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Uso1_p115_head Uso1_p115_C APG6_N DivIC GAS Spc7 Filament Arm_vescicular
Motif
Other DBs
NCBI-GeneID: 851501
NCBI-ProteinID: NP_010225
SGD: S000002216
UniProt: P25386
Position
IV:345665..351037
Genome map
AA seq 1790 aa AA seqDB search
MDIIQGLIQQPKIQSVDETIPTLCDRVENSTLISDRRSAVLGLKAFSRQYRESVIASGLK
PLLNTLKRDYMDEDSVKAILETILILFIRGDGHDDLTRGWISQQSRLQNGKYPSPLVMKQ
EKEQVDQFSLWIADALTQSEDLIHLLVEFWEIDNFHIRLYTIQLLEAVMATRPLKARSAL
ISLPTSISTMVSLLDDMHEPIRDEAILLLMAVVNDSPHVQKLVAFENIFERLFSIIEEEG
GLRGSLVVNDCLSLINNILKYNTSNQTLFLETGNLPKLAHLLSEPISQDEVFFWNDQRIV
NINTALDIVSLTVEPGNTVTTKHQNALLDSSVLMVVLRLAFFHNIPKKVRPVALLTAANM
VRSNEHAQLEFSKIDVPYFDPSLPVNSTANGGPIKLIPVVSILINWMLYANSVHTFDTRV
ACSRLLKAYFMDNFDLQRDFLLKQVQLCNNSTNNVGDNAKENGGSNKSDKESDSDKDTDG
KDGTEYEGSFKANLFEVLLNYDAELNLNPFKLFFTTDIFMFFFQQDHKYSEELREITRNV
TTGNDLEDEEPLKAIQTISELLTTSLTAADIRIPISYLTFLIYWLFGDFKATNDFLSDKS
VIKSLLSFSYQIQDEDVTIKCLVTMLLGVAYEFSSKESPFPRKEYFEFITKTLGKDNYAS
RIKQFKKDSYFSKVDMNEDSILTPELDETGLPKVYFSTYFIQLFNENIYRIRTALSHDPD
EEPINKISFEEVEKLQRQCTKLKGEITSLQTETESTHENLTEKLIALTNEHKELDEKYQI
LNSSHSSLKENFSILETELKNVRDSLDEMTQLRDVLETKDKENQTALLEYKSTIHKQEDS
IKTLEKGLETILSQKKKAEDGINKMGKDLFALSREMQAVEENCKNLQKEKDKSNVNHQKE
TKSLKEDIAAKITEIKAINENLEEMKIQCNNLSKEKEHISKELVEYKSRFQSHDNLVAKL
TEKLKSLANNYKDMQAENESLIKAVEESKNESSIQLSNLQNKIDSMSQEKENFQIERGSI
EKNIEQLKKTISDLEQTKEEIISKSDSSKDEYESQISLLKEKLETATTANDENVNKISEL
TKTREELEAELAAYKNLKNELETKLETSEKALKEVKENEEHLKEEKIQLEKEATETKQQL
NSLRANLESLEKEHEDLAAQLKKYEEQIANKERQYNEEISQLNDEITSTQQENESIKKKN
DELEGEVKAMKSTSEEQSNLKKSEIDALNLQIKELKKKNETNEASLLESIKSVESETVKI
KELQDECNFKEKEVSELEDKLKASEDKNSKYLELQKESEKIKEELDAKTTELKIQLEKIT
NLSKAKEKSESELSRLKKTSSEERKNAEEQLEKLKNEIQIKNQAFEKERKLLNEGSSTIT
QEYSEKINTLEDELIRLQNENELKAKEIDNTRSELEKVSLSNDELLEEKQNTIKSLQDEI
LSYKDKITRNDEKLLSIERDNKRDLESLKEQLRAAQESKAKVEEGLKKLEEESSKEKAEL
EKSKEMMKKLESTIESNETELKSSMETIRKSDEKLEQSKKSAEEDIKNLQHEKSDLISRI
NESEKDIEELKSKLRIEAKSGSELETVKQELNNAQEKIRINAEENTVLKSKLEDIERELK
DKQAEIKSNQEEKELLTSRLKELEQELDSTQQKAQKSEEERRAEVRKFQVEKSQLDEKAM
LLETKYNDLVNKEQAWKRDEDTVKKTTDSQRQEIEKLAKELDNLKAENSKLKEANEDRSE
IDDLMLLVTDLDEKNAKYRSKLKDLGVEISSDEEDDEEDDEEDEEEGQVA
NT seq 5373 nt NT seq  +upstreamnt  +downstreamnt
atggacatcattcaaggactgatacagcaaccaaaaattcaatctgtggatgaaaccatt
ccgacgttgtgcgatcgagttgagaactccactttgattagcgataggagatccgctgtg
ctgggattaaaggcatttagccggcagtatagagaatcagtgattgcatccgggctaaaa
ccgttgctcaatactttgaaacgtgattatatggatgaagattcggtaaaggctatatta
gaaacaattttgattcttttcatcagaggcgatggccatgacgacttaactagaggttgg
atttctcaacaatcgcggttgcagaatggcaagtatccctcaccattggtgatgaagcaa
gaaaaggaacaagtagatcagttctcgttatggattgctgatgctttgacgcagtctgaa
gatttaattcacctacttgttgaattttgggaaatcgataatttccatattagattgtac
acaattcaattactagaggcagtgatggccacgaggccgttgaaggcgagaagtgctttg
atttcacttccaacgagcatatccacaatggtctcactcctagatgacatgcatgagccc
atcagggatgaagctattttattattaatggcagtagtgaacgattcacctcacgttcaa
aaattggttgcttttgaaaacatttttgaaaggctcttttccatcatcgaagaagaaggt
gggttaagaggctctctcgtcgtcaatgattgtttatcgttgatcaataacatcctgaag
tataacacttctaatcaaactttattccttgagacaggaaacttgccaaaactggcacac
cttttgagtgaaccaatatctcaagatgaagtttttttttggaatgatcaaaggatagtt
aatatcaatacagctttagatatcgtcagcctaacagtagagccaggaaatactgtcacc
actaagcatcaaaatgcgttgcttgactcaagcgtattaatggttgtgttgcgacttgca
ttctttcataatatcccaaaaaaagttagaccggttgctcttttgactgccgcaaacatg
gttagaagtaatgaacatgcacagctagagtttagtaagatcgatgttccatatttcgat
ccttcattacctgtaaactctactgcaaacggtggtccaattaaattaattcctgtagtc
agcatcttgataaattggatgctctatgccaactccgttcacacgtttgatacaagagtt
gcgtgttctagactattaaaggcttatttcatggataattttgatcttcaaagagatttt
ttactaaaacaagtccaattgtgtaataattcaacaaataatgtcggcgacaatgctaaa
gaaaatggtggttctaacaaatctgataaagaaagtgattcagataaagataccgacggg
aaggatggcactgaatatgaaggttctttcaaggcaaatctattcgaagtcctgttaaat
tatgacgcagaattgaatctgaacccttttaaattattcttcacaactgatatttttatg
ttttttttccaacaggatcacaaatatagcgaagaactacgtgaaataacaagaaatgtt
accaccggtaacgatctcgaagacgaagaacccttaaaggcaattcaaacaataagtgaa
ttgctaactacttcccttactgctgctgacataagaattcctatttcctacttaacgttc
ctaatatattggctctttggcgactttaaggccacgaacgattttctttcggataaatcc
gtgattaaatccttgctttccttctcttaccaaattcaagatgaagacgttactatcaaa
tgccttgtaacaatgttactaggtgtggcatacgagttttcctcgaaagaatctccattc
ccaagaaaggaatacttcgaattcatcactaaaactttgggaaaagacaattatgcttct
cgaatcaaacaatttaaaaaagattcatatttctcaaaagttgatatgaatgaagacagt
atactaactccggagcttgatgaaactggtttaccaaaagtttatttcagcacttacttc
atacagttatttaatgaaaacatatacaggatcagaactgcattgtctcacgaccctgac
gaagagccaatcaataaaatatctttcgaagaagtcgaaaaattacagaggcaatgtaca
aaattgaagggtgagataacttctttgcaaacagaaacggaaagcacccatgagaacctc
accgaaaaattgattgcgttgactaatgaacacaaagagttggatgagaaataccaaatt
ttgaattcctcacattcttcgttgaaagaaaacttttccattttggaaactgaattgaag
aacgtcagagattccttggatgaaatgacgcaactgagagatgtactggaaactaaggac
aaagaaaatcaaactgctttactggagtacaaaagcacaatccacaaacaagaagactct
atcaaaactttagaaaaaggacttgaaactattttgtctcaaaagaaaaaggcagaagat
ggtataaacaaaatgggtaaagatttattcgctctgagtagagagatgcaagcagttgag
gagaattgtaaaaatttacagaaggaaaaagataaaagcaatgtcaaccatcagaaagag
actaaatcactaaaagaagatattgcggcaaaaattactgaaataaaagctatcaatgaa
aatctggaagaaatgaaaattcaatgtaataatttatcaaaagaaaaggaacatatttcg
aaggaacttgttgagtacaaatcccgctttcagagtcatgacaatctagtagcgaaacta
acagaaaaattgaaatccttagcaaataactataaggatatgcaagctgaaaatgagtct
ctaataaaagctgtagaagagtcaaaaaacgaaagcagcatacaattgtctaatttgcaa
aataaaattgattctatgtcacaggaaaaagaaaattttcaaatagaaagaggcagtata
gaaaaaaatatcgaacaactaaaaaaaaccatctctgacttagaacaaacgaaggaggaa
attatctcaaaatccgattcttcaaaagatgaatatgagtcccagattagtctcttgaaa
gaaaaattagaaacggcgacaacagcaaacgatgaaaacgtgaataaaatctcagaattg
actaaaactagggaagagctggaagccgagttagcagcttataaaaatctcaaaaatgaa
cttgaaacaaaactagaaacttcagagaaagctttgaaagaagttaaagaaaacgaggag
catttaaaagaagagaaaattcaactcgagaaggaggccactgaaaccaaacagcaactc
aacagcctacgtgccaatttagaatcattagaaaaagagcatgaagatttagcagctcag
ttgaagaagtacgaggagcaaattgccaacaaggaaaggcaatataacgaggaaatatct
caattaaatgatgagattacttccactcaacaagaaaatgaatcaattaagaaaaaaaat
gacgaactggagggcgaagttaaagcaatgaagagcacttcagaggaacaatcaaatttg
aaaaagtcagagattgatgccttaaatttgcaaattaaagagctgaaaaagaagaacgaa
acgaacgaagccagtttattggagtcaatcaaaagtgtagaatcagaaacggtaaaaatt
aaagaattacaagacgaatgtaactttaaagaaaaggaagttagtgaattggaagacaaa
ctcaaggcctcagaagataagaactctaaatatttggagctacagaaggaatcggagaag
ataaaagaagaactagatgctaaaacgactgaactaaaaattcaattggaaaagatcact
aatttatctaaggccaaggagaaatcagaatctgagttgtctagattgaagaagacatct
tctgaggaaagaaaaaatgcagaggagcaattggaaaaattgaaaaatgaaatacaaatc
aaaaatcaggccttcgaaaaggaaagaaagctacttaatgaaggatcttcaacaattaca
caagaatattctgaaaagatcaatactttggaagatgaattaattaggctacaaaatgaa
aacgaattaaaagccaaagagatcgataatacgaggagtgaactagagaaggttagttta
agcaatgatgagcttttagaagagaaacaaaacacaataaaaagcttacaagatgaaatt
ctttcatataaagacaaaataactagaaatgacgaaaagcttctatcaatagagcgagat
aataaacgagacctggagagcttgaaagaacaactccgggctgcacaagaatccaaagct
aaagttgaagaagggctgaaaaaacttgaggaagaatcttcaaaagagaaagcagagctt
gaaaagtctaaagaaatgatgaaaaagctagagagtacgattgagagcaatgaaacggag
ttgaaatcctcaatggaaaccataaggaaatcagatgaaaaattagaacagtcgaaaaaa
agtgctgaggaggatattaaaaacttgcaacatgagaagtcagatttgatatcccgaatc
aacgaatctgaaaaggatattgaagaactgaaaagtaaactgaggatcgaagcaaaatct
ggctctgaactagaaaccgtaaaacaagagctaaataacgcacaagaaaaaataaggatc
aacgcagaagaaaatacagttttgaaatctaaattagaagatatagaacgtgaactcaaa
gacaagcaagccgaaataaaaagtaatcaagaagaaaaagaattactaacttcgcgcctc
aaggaattagaacaggaattagatagcacccaacagaaggcacaaaaatccgaggaagaa
cgtagggccgaagtcaggaagtttcaagtcgaaaagtctcaacttgatgaaaaagccatg
ttgcttgaaactaaatacaacgatttggtgaataaagagcaagcatggaaaagggatgaa
gatactgttaaaaagacaaccgattctcagagacaagaaattgaaaagttggctaaagaa
ctggataacttgaaggcagagaactctaagttgaaggaagctaacgaagatcgttcggaa
attgatgacttgatgctcttggttactgacctagatgagaaaaacgccaaatatcgctca
aagctgaaggatttgggcgttgaaattagttcggatgaagaggatgatgaagaagatgat
gaagaagacgaggaagaagggcaagtggcatga

DBGET integrated database retrieval system