KEGG   Saccharomyces cerevisiae (budding yeast): YDL060WHelp
Entry
YDL060W           CDS       T00005                                 

Gene name
TSR1
Definition
(RefSeq) Tsr1p
  KO
K14799  pre-rRNA-processing protein TSR1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sce03009]
    YDL060W (TSR1)
Ribosome biogenesis [BR:sce03009]
 Eukaryotic Type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    YDL060W (TSR1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RIBIOP_C AARP2CN NAD_binding_10
Motif
Other DBs
NCBI-GeneID: 851499
NCBI-ProteinID: NP_010223
SGD: S000002218
UniProt: Q07381
Structure
PDB: 

Position
IV:341619..343985
Genome map
AA seq 788 aa AA seqDB search
MAGHSHRSSLKNGHKSYKSKHASKGALKRLYKGKVEKEPVGTGKPDKQVSKLQRKNKAKQ
LRAQRILDSIENRKLFEGKNGAAKIITIVPLVNDLDPLDILYKLLKCADDEGIMVQEVDS
KRIFNVHIKKFKSNLKIIIPDMTNFLNILDCAKVADFVVFGLSGVQEVDEEFGEQIIRAL
ELQGIASYIGVISNLSAVHEKEKFQLDVKQSLESYFKHFFPSEERVYNLEKNSDALNVLR
TLCQRLPRSINWRDNRGYVVADFVDFVETSPDSGDLVIEGTVRGIGFNANRLVHIPDFGD
FQLNKIEKISESSQKRKIIKEKATDSLSLELDLQTVFESNMNRDTLDEYAPEGTEDWSDY
DEDFEYDGLTTARYDDHGFLPGREQTSKKAAVPKGTSDYQAKWYLDDVIDANEEEEAEQT
NGKDETMMEIDDEMMVEQDNEEVAGDEEYDIEDNEGFEELSPEEEERQLREFRDMEKEDR
EFPDEIELEPSESAIERLKRYRGLKNLYNCDWQVDEKDPSSPAEWKRLLRIGNYKNTKNR
IIKETKNEAQAIAGDRIRMFIRFPKFLLEKIQDPKQLLFAVYGLLLHEHKNAVVNFSLQR
WEQYDKPVPSQEPIVVQYGVRRYTIQPLFSQGSNSPNNVHKYERFLHPDTVSVATCIAPV
DFTQSPAIFFKPSPTDAKNIELIGHGTFLNADHSRILAKRAILTGHPFRFHKTVVTVRYM
FFRPEDVEWFKSIPLFTKSGRSGFIKESLGTHGYFKATFDGKLSAQDVVAMSLYKRMWPM
PSLPWNGM
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtcattcacacaggtcatcattaaaaaacggacacaaatcttacaaatccaaa
catgcttctaaaggtgctttgaaaagattatacaaggggaaagtggaaaaagaacccgtg
ggcactggcaaaccagacaaacaagtttcaaaattgcaacgtaaaaacaaggcaaaacaa
ttaagggcccaaaggatcttggattccattgaaaacaggaaattattcgaaggaaaaaat
ggcgctgccaaaatcattactattgttccgttagtgaatgatttagacccattggacatt
ctttacaagctattaaagtgtgcagatgatgaaggaatcatggtgcaggaagtagactca
aaacgtatatttaatgttcatataaagaagtttaaaagcaatcttaaaatcataattcca
gacatgaccaattttttgaacattttagattgcgctaaagtagcagactttgttgtgttt
gggctcagtggtgtccaagaagtcgatgaagaatttggtgagcagatcatccgtgcgtta
gaactacaaggtattgcttcatatatcggtgtcataagcaacctctcagcagtccatgaa
aaggagaaattccaattggatgtcaagcaatccttagaaagttatttcaagcactttttc
ccaagtgaagaacgtgtttataatttggaaaaaaactcagacgctttaaacgtcttgaga
acattgtgccagaggctaccaagatcaatcaattggagagacaatagaggttacgtagtc
gctgactttgttgatttcgttgaaacctctcccgattctggtgacctggtaattgagggg
accgtccgtggtattggcttcaacgccaatagactggtccatattcctgattttggtgac
ttccaactgaataagatagaaaaaatcagtgaatcttcgcagaaaaggaaaataataaag
gaaaaagctacagatagtctgagcttagagctggatttacaaacagttttcgaaagtaat
atgaatagagatactttggacgaatatgccccagaaggcacggaagattggtcagattat
gacgaggattttgagtacgacggtttgacaaccgcgagatacgacgaccatggcttcttg
ccagggagggaacaaacatcaaaaaaggcggcagttcctaagggaacttctgactatcaa
gcgaagtggtacttggatgacgtcattgacgcaaatgaggaagaagaggcagaacagacc
aatggaaaggatgagacaatgatggaaattgatgatgaaatgatggtggagcaagacaat
gaagaggtagcaggcgacgaagaatatgacatagaggataatgaaggatttgaagagctt
tcacccgaagaagaagaacgtcaactgagggaatttagagatatggaaaaggaggacaga
gagttccccgatgagatcgaactagagcccagtgaatctgccatcgaacgtttgaaaagg
tatagaggtttgaaaaacttatacaactgtgattggcaagttgatgaaaaggacccatca
tcaccagcggaatggaaacgtctattaaggattggcaattacaaaaacactaaaaacaga
atcataaaggaaaccaagaatgaagcacaggccattgcaggtgatcgtattaggatgttc
atcaggtttcctaagtttctgcttgaaaagattcaagatcctaaacaactattatttgct
gtctacggattactacttcatgaacacaaaaatgcggtagtcaacttctctctacaaaga
tgggaacaatatgacaaacctgtgccttctcaggagcctatcgtagtacaatacggtgtt
agaagatacactattcaacctctattttctcaaggctctaacagtcctaataatgttcac
aagtatgaaaggtttctgcatccagatacagtatcagttgccacatgtattgctcccgta
gatttcacccagtcacctgcaatttttttcaagccatcaccaacagatgccaaaaatatt
gaattgattggtcacggtacattcctgaatgcagaccattcaagaatattagcaaagaga
gccattttgaccggtcatccattcagattccacaaaactgtggttactgtacgttacatg
tttttcagaccagaagatgtggaatggttcaagtctatcccactgttcaccaaatcaggt
aggtcaggtttcattaaagaaagtttgggtacgcatggttatttcaaggctacatttgat
ggtaaattatctgcgcaggatgttgttgctatgtccttgtacaaacgtatgtggcccatg
ccttcgttaccttggaatggtatgtaa

DBGET integrated database retrieval system