KEGG   Saccharomyces cerevisiae (budding yeast): YDL065CHelp
Entry
YDL065C           CDS       T00005                                 

Gene name
PEX19, PAS12
Definition
(RefSeq) Pex19p
  KO
K13337  peroxin-19
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    YDL065C (PEX19)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pex19 Spore_III_AB DUF2070
Motif
Other DBs
NCBI-GeneID: 851494
NCBI-ProteinID: NP_010218
SGD: S000002223
UniProt: Q07418
Position
IV:complement(336249..337277)
Genome map
AA seq 342 aa AA seqDB search
MNENEYDNFDDLDDLLDEDPTKLDEAEPDDVQAKGSVYNDSENKEKNAESKDSDGVQVAN
ESEEDPELKEMMVDLQNEFANLMKNNGNENNVKTEDFNKLISALEEAAKVPHQQMEQGCS
SLKSNSTDKGTVNGSNPGFKNIVSNTLDRLKENGNKVDTSLAEETKESQRSGQNNNIDDI
LSQLLDQMVASGGKESAENQFDLKDGEMDDAITKILDQMTSKEVLYEPMKEMRSEFGVWF
QENGENEEHKEKIGTYKRQFNIVDEIVNIYELKDYDELKHKDRVTELLDELEQLGDSPIR
SANSPLKHGNEEEELMKMLEIDGNDPNLGNLDKELTDGCKQQ
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaaacgagtacgataattttgatgatttggatgaccttttagatgaagatccc
actaaactggatgaagcagagcccgatgatgtgcaagcgaagggttctgtgtacaacgat
agtgaaaacaaagagaagaatgccgaaagtaaggacagtgatggcgtacaggtagctaat
gaatctgaagaggacccagaattgaaagaaatgatggtagatttgcaaaatgagttcgca
aatttgatgaaaaataacggtaacgagaataatgtgaagacagaagattttaataaactg
attagtgctctagaagaggcagctaaagtacctcatcaacagatggagcaaggatgtagt
agtttgaaaagtaacagcactgataaagggaccgtgaatggtagcaatccgggatttaaa
aacattgtttccaatacgctagacaggttaaaggaaaatggtaataaagttgatacatcc
ctagccgaagaaaccaaggaatctcaacgcagtggccaaaataataatattgatgatata
ttgtcacaattattagatcaaatggtagcatctggtggaaaagaaagtgcagaaaatcaa
tttgatctaaaagatggggagatggacgacgcaataacaaaaatacttgatcaaatgacg
tcaaaagaagtattatatgagcctatgaaagaaatgcgtagtgagttcggtgtttggttt
caagaaaacggtgaaaatgaagagcataaggaaaagataggcacctacaagaggcaattt
aatatcgtagacgaaattgtaaatatttatgaattgaaagattatgacgagctaaagcat
aaagatcgtgttactgaacttttggacgaattagaacagcttggtgatagccctattaga
agtgcgaacagccccctaaaacacggtaatgaagaagaagaactcatgaaaatgttggaa
attgatggtaatgatccgaacttggggaaccttgataaggaattaaccgacggttgcaaa
caacaataa

DBGET integrated database retrieval system