KEGG   Saccharomyces cerevisiae (budding yeast): YDL067CHelp
Entry
YDL067C           CDS       T00005                                 

Gene name
COX9
Definition
(RefSeq) cytochrome c oxidase subunit VIIa
  KO
K02269  cytochrome c oxidase subunit 7
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00190  Oxidative phosphorylation
sce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    YDL067C (COX9)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FSH1
Motif
Other DBs
NCBI-GeneID: 851492
NCBI-ProteinID: NP_010216
SGD: S000002225
UniProt: P07255
Structure
PDB: 

Position
IV:complement(334217..334396)
Genome map
AA seq 59 aa AA seqDB search
MTIAPITGTIKRRVIMDIVLGFSLGGVMASYWWWGFHMDKINKREKFYAELAERKKQEN
NT seq 180 nt NT seq  +upstreamnt  +downstreamnt
atgactattgctccaattactggtacgatcaagagaagagtcatcatggacatcgtcctc
gggttctccctcgggggtgtcatggcctcttactggtggtggggattccacatggataag
attaacaagagagagaagttctacgcagagctagctgagaggaaaaagcaagagaactga

DBGET integrated database retrieval system