KEGG   Saccharomyces cerevisiae (budding yeast): YDL072C
Entry
YDL072C           CDS       T00005                                 

Gene name
YET3
Definition
(RefSeq) Yet3p
  KO
K14009  B-cell receptor-associated protein 31
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YDL072C (YET3)
Motif
Pfam: Bap31 Osmo_CC Spc24
Other DBs
NCBI-GeneID: 851487
NCBI-ProteinID: NP_010211
SGD: S000002230
UniProt: Q07451
Position
IV:complement(329836..330447)
AA seq 203 aa
MSLYYTLVFAILVVEIFMFSILALPIPSRYRRPLTLLLLKPFKSSTVQVAIKCVLGFILL
LFIDCINRVYSIDKELQLSSASQNNGAIIAQDRIEVLSRKFFAQRNMYLTGITLFLTFVV
VRTFGLVIELLTMKDIYRASPPVASSDVKKNDSVTAEAAAQSGASKDDHGDEKNFELLKK
IQDIDDEIARLKEKSESLQEEIN
NT seq 612 nt   +upstreamnt  +downstreamnt
atgtcattatattacaccttggtttttgccattctagtggtggagattttcatgttctcc
attctagccctaccaatcccttctagataccgtaggcctctcaccttactgttattaaag
ccgttcaaatcctccacagtgcaagttgcgatcaagtgtgtacttgggttcattcttttg
cttttcatcgattgtatcaacagagtgtacagcatcgacaaagagctgcagttaagtagc
gcctctcaaaataatggcgctataatcgctcaagatagaattgaggttctttctaggaaa
ttctttgcccaaaggaatatgtatttgacaggtataactttgtttttgacctttgtcgtc
gttaggacttttgggctagtcatagaacttttaaccatgaaagacatatacagagcatcg
cctccagtagcctccagcgatgtcaagaagaacgactctgttactgccgaagctgctgct
caatccggcgcttccaaggatgaccacggcgatgagaaaaattttgaactattgaagaaa
attcaggacatcgatgacgaaattgcacgtttaaaggagaagtcggaatcgttgcaagaa
gaaataaattag

DBGET integrated database retrieval system