KEGG   Saccharomyces cerevisiae (budding yeast): YDL084WHelp
Entry
YDL084W           CDS       T00005                                 

Gene name
SUB2
Definition
(RefSeq) ATP-dependent RNA helicase SUB2
  KO
K12812  ATP-dependent RNA helicase UAP56/SUB2 [EC:3.6.4.13]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03013  RNA transport
sce03015  mRNA surveillance pathway
sce03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    YDL084W (SUB2)
  09122 Translation
   03013 RNA transport
    YDL084W (SUB2)
   03015 mRNA surveillance pathway
    YDL084W (SUB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sce03019]
    YDL084W (SUB2)
   03041 Spliceosome [BR:sce03041]
    YDL084W (SUB2)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     YDL084W (SUB2)
Messenger RNA biogenesis [BR:sce03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     YDL084W (SUB2)
Spliceosome [BR:sce03041]
 Complex C
  Other components
   EJC/TREX
    YDL084W (SUB2)
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    YDL084W (SUB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C ResIII
Motif
Other DBs
NCBI-GeneID: 851475
NCBI-ProteinID: NP_010199
SGD: S000002242
UniProt: Q07478
Structure
PDB: 

Position
IV:305237..306577
Genome map
AA seq 446 aa AA seqDB search
MSHEGEEDLLEYSDNEQEIQIDASKAAEAGETGAATSATEGDNNNNTAAGDKKGSYVGIH
STGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLST
LQQLDPVPGEVAVVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPISKDAELLKN
KDTAPHIVVATPGRLKALVREKYIDLSHVKNFVIDECDKVLEELDMRRDVQEIFRATPRD
KQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLEEREKNRKLAQL
LDDLEFNQVIIFVKSTTRANELTKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRIC
VSTDVFGRGIDIERINLAINYDLTNEADQYLHRVGRAGRFGTKGLAISFVSSKEDEEVLA
KIQERFDVKIAEFPEEGIDPSTYLNN
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgtcacacgaaggtgaagaagatttattggagtactccgataacgaacaagaaattcaa
attgatgcctctaaggccgctgaagctggagaaactggcgccgccacttctgcaactgaa
ggtgataataataacaacactgcagctggcgacaagaaaggttcctatgttggtatccat
tccaccggtttcaaagatttcttgctaaagccagaactatcaagagccatcattgactgt
ggttttgaacatccttctgaggtccagcaacataccattcctcagtcaattcatggtacc
gatgtcttgtgtcaagcaaagtctggtttaggtaagacagctgtctttgtcttatccact
ctgcaacaattggaccctgttccaggtgaagttgccgttgttgtcatttgtaatgctaga
gaactggcctatcaaattcgtaacgagtatttgagattttccaaatatatgccagacgtt
aagacagcagtcttttacggtggtactccaatttctaaggatgctgaacttttaaagaat
aaagatactgctcctcacattgttgttgcaactccaggtcgtttaaaagcgttagtgaga
gaaaaatacattgatttgtcacacgtcaagaactttgtcatagatgaatgtgataaggtt
ttagaagaattagacatgagaagagatgtgcaagaaattttcagagctactccaagagac
aaacaagtcatgatgttttcagccacactttctcaagaaattagaccaatttgtagacgc
ttcttacagaatccattggaaattttcgtcgatgatgaagctaagctaaccttgcacggg
ttgcaacaatattatatcaaattagaagaacgtgaaaagaaccgtaaattggctcaatta
ttagatgatttggagttcaatcaagtcattattttcgttaaatctaccacaagagctaat
gagttgaccaaactattaaacgcctctaactttccggctatcaccgttcatggtcatatg
aaacaagaagaacgtattgctcgttacaaggctttcaaagattttgaaaaacgtatttgc
gtgtccacagatgtttttggtagaggtatcgatattgaacgtattaatttagccatcaat
tacgatttgactaatgaagctgaccaatatttacatcgtgtcggtagagctggtagattt
ggtactaagggtttggctatttcattcgtttcttcaaaggaagatgaggaagtcttggct
aagatccaagagcgtttcgatgtcaaaatcgctgaattcccagaagaaggcattgatccg
tccacttatttgaataattaa

DBGET integrated database retrieval system