KEGG   Saccharomyces cerevisiae (budding yeast): YDL092W
Entry
YDL092W           CDS       T00005                                 

Gene name
SRP14
Definition
(RefSeq) RNA-binding signal recognition particle subunit SRP14
  KO
K03104  signal recognition particle subunit SRP14
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03060  Protein export
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    YDL092W (SRP14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sce02044]
    YDL092W (SRP14)
Secretion system [BR:sce02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   YDL092W (SRP14)
SSDB
Motif
Pfam: SRP14 FixG_C Lipocalin_9
Other DBs
NCBI-GeneID: 851466
NCBI-ProteinID: NP_010191
SGD: S000002250
UniProt: P38985
Position
IV:292781..293221
AA seq 146 aa
MANTGCLSPGAFLSKVPEFFQTANEKHITVRLTAKRLIEHDPVEGNLEFDSTNHPDYDVS
KKASEISVSSRSDREYPLLIRMSYGSHDKKTKCSTVVKASELDQFWQEYSSVFKGGMQNL
IKKKKKKSKNGTISKTGKKNKVAKKN
NT seq 441 nt   +upstreamnt  +downstreamnt
atggcaaatactggctgtttatcaccaggtgcatttttatcaaaggttccagaatttttc
cagactgcgaatgaaaaacatataactgtgcgtctaacggccaaaagactcatagaacac
gatcctgtggaagggaatcttgaatttgattctaccaaccatcctgactatgatgtatct
aaaaaggcttctgaaatttcagttagctcaagatctgacagagaatacccactattaatc
agaatgtcttatggctcgcatgacaagaaaacaaaatgctcaacagtggtaaaagcaagt
gagttagatcaattttggcaagagtattcatctgtatttaaggggggcatgcagaatttg
atcaagaagaagaaaaagaagagtaagaacggtaccatcagtaagacaggaaagaaaaac
aaggtagcgaagaaaaactga

DBGET integrated database retrieval system