KEGG   Saccharomyces cerevisiae (budding yeast): YDL100CHelp
Entry
YDL100C           CDS       T00005                                 

Gene name
GET3, ARR4
Definition
(RefSeq) guanine nucleotide exchange factor GET3
  KO
K01551  arsenite/tail-anchored protein-transporting ATPase [EC:3.6.3.16 3.6.3.-]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YDL100C (GET3)
Enzymes [BR:sce01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.16  arsenite-transporting ATPase
     YDL100C (GET3)
    3.6.3.-  
     YDL100C (GET3)
Transporters [BR:sce02000]
 Other Transporters
  Primary active transporters [TC:3]
   YDL100C (GET3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArsA_ATPase AAA_31 CbiA ParA Fer4_NifH SRP54 AAA_25 AAA_24 NACHT PhoH
Motif
Other DBs
NCBI-GeneID: 851458
NCBI-ProteinID: NP_010183
SGD: S000002258
UniProt: Q12154
Structure
PDB: 

Position
IV:complement(282112..283176)
Genome map
AA seq 354 aa AA seqDB search
MDLTVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAH
NLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSRANNNGSDGQGDDLGSL
LQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLP
NTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVC
VCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLD
QIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELEDKE
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggatttaaccgtggaacctaatttgcactctttaattacctctaccactcataagtgg
attttcgttggtggtaaaggtggtgttggtaagactacttcatcatgttccattgctatc
caaatggctttgagtcaaccaaacaaacagttcctactgatctctactgatcctgcccat
aacttaagtgatgcattcggtgagaaatttggtaaagacgccagaaaggtgacaggcatg
aataatctatcatgtatggaaatcgatccatccgctgctttgaaggatatgaacgacatg
gcagtttcacgcgctaacaataacggaagtgacggtcaaggtgacgatctaggaagcttg
cttcaaggtggtgctcttgctgatttgaccggttccatccctggtatcgacgaagcttta
tccttcatggaagtcatgaagcacattaaaaggcaagaacagggcgaaggtgaaaccttc
gatactgttatttttgacactgctccaactggccacacattaagatttctacaactacca
aatactttatccaagcttttggaaaagttcggtgaaattaccaacaaattgggcccaatg
ctaaactcttttatgggcgcaggtaatgtcgatatctctggaaaattgaacgagttaaag
gctaatgtcgagaccatcagacaacaattcacggatcctgacctaacgacttttgtttgc
gtttgtatcagtgaattcttatccttatatgaaactgaaagactaattcaggaattgatt
tcctacgatatggacgttaattccatcattgtcaaccaattattatttgctgaaaacgat
caagagcacaactgtaagagatgtcaggcaagatggaagatgcaaaagaagtacttggac
caaatcgacgaattgtacgaagatttccatgtcgttaaaatgccattatgtgctggagaa
atcagaggcttaaataacttaacaaagttctcacagttcctaaacaaagaatataaccct
attactgatggcaaagtcatttatgagttagaagataaggaatag

DBGET integrated database retrieval system