KEGG   Saccharomyces cerevisiae (budding yeast): YDL102WHelp
Entry
YDL102W           CDS       T00005                                 

Gene name
POL3, CDC2, HPR6, TEX1
Definition
(RefSeq) DNA-directed DNA polymerase delta POL3
  KO
K02327  DNA polymerase delta subunit 1 [EC:2.7.7.7]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce03030  DNA replication
sce03410  Base excision repair
sce03420  Nucleotide excision repair
sce03430  Mismatch repair
sce03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    YDL102W (POL3)
   03410 Base excision repair
    YDL102W (POL3)
   03420 Nucleotide excision repair
    YDL102W (POL3)
   03430 Mismatch repair
    YDL102W (POL3)
   03440 Homologous recombination
    YDL102W (POL3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sce03032]
    YDL102W (POL3)
   03400 DNA repair and recombination proteins [BR:sce03400]
    YDL102W (POL3)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     YDL102W (POL3)
DNA replication proteins [BR:sce03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    YDL102W (POL3)
DNA repair and recombination proteins [BR:sce03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      YDL102W (POL3)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     YDL102W (POL3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 zf-C4pol DNA_pol_B_2 DNA_pol_B_exo2 cwf18
Motif
Other DBs
NCBI-GeneID: 851456
NCBI-ProteinID: NP_010181
SGD: S000002260
UniProt: P15436
Structure
PDB: 

Position
IV:276872..280165
Genome map
AA seq 1097 aa AA seqDB search
MSEKRSLPMVDVKIDDEDTPQLEKKIKRQSIDHGVGSEPVSTIEIIPSDSFRKYNSQGFK
AKDTDLMGTQLESTFEQELSQMEHDMADQEEHDLSSFERKKLPTDFDPSLYDISFQQIDA
EQSVLNGIKDENTSTVVRFFGVTSEGHSVLCNVTGFKNYLYVPAPNSSDANDQEQINKFV
HYLNETFDHAIDSIEVVSKQSIWGYSGDTKLPFWKIYVTYPHMVNKLRTAFERGHLSFNS
WFSNGTTTYDNIAYTLRLMVDCGIVGMSWITLPKGKYSMIEPNNRVSSCQLEVSINYRNL
IAHPAEGDWSHTAPLRIMSFDIECAGRIGVFPEPEYDPVIQIANVVSIAGAKKPFIRNVF
TLNTCSPITGSMIFSHATEEEMLSNWRNFIIKVDPDVIIGYNTTNFDIPYLLNRAKALKV
NDFPYFGRLKTVKQEIKESVFSSKAYGTRETKNVNIDGRLQLDLLQFIQREYKLRSYTLN
AVSAHFLGEQKEDVHYSIISDLQNGDSETRRRLAVYCLKDAYLPLRLMEKLMALVNYTEM
ARVTGVPFSYLLARGQQIKVVSQLFRKCLEIDTVIPNMQSQASDDQYEGATVIEPIRGYY
DVPIATLDFNSLYPSIMMAHNLCYTTLCNKATVERLNLKIDEDYVITPNGDYFVTTKRRR
GILPIILDELISARKRAKKDLRDEKDPFKRDVLNGRQLALKISANSVYGFTGATVGKLPC
LAISSSVTAYGRTMILKTKTAVQEKYCIKNGYKHDAVVVYGDTDSVMVKFGTTDLKEAMD
LGTEAAKYVSTLFKHPINLEFEKAYFPYLLINKKRYAGLFWTNPDKFDKLDQKGLASVRR
DSCSLVSIVMNKVLKKILIERNVDGALAFVRETINDILHNRVDISKLIISKTLAPNYTNP
QPHAVLAERMKRREGVGPNVGDRVDYVIIGGNDKLYNRAEDPLFVLENNIQVDSRYYLTN
QLQNPIISIVAPIIGDKQANGMFVVKSIKINTGSQKGGLMSFIKKVEACKSCKGPLRKGE
GPLCSNCLARSGELYIKALYDVRDLEEKYSRLWTQCQRCAGNLHSEVLCSNKNCDIFYMR
VKVKKELQEKVEQLSKW
NT seq 3294 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaaaagatcccttcccatggttgatgtgaagatcgatgacgaggatactccc
cagttggaaaagaaaatcaaacggcaatcaatagatcatggtgttggaagtgaacctgtt
tcaacaatagagattattccgagtgattcttttcgaaaatataatagtcaaggcttcaaa
gcaaaggatacagatttaatgggtacgcaattagagtctacttttgaacaagagctatcg
caaatggaacatgatatggccgaccaagaagagcatgacctgtcatcattcgagcgtaag
aaacttccaaccgattttgacccaagtttgtatgatatttctttccaacaaattgatgcg
gaacagagcgtactgaatggtatcaaagatgaaaatacatctaccgtggtaaggtttttt
ggtgtcactagtgaaggacactctgtactttgtaatgttacagggttcaagaactatctt
tacgtcccagcgcccaattcttccgacgctaacgatcaggagcaaatcaacaagtttgtg
cactatttaaacgaaacatttgaccacgctattgattcgattgaagttgtatctaaacag
tctatctggggttattccggagataccaaattaccattctggaaaatatacgtcacctat
ccgcatatggtcaacaaactgcgtactgcgtttgaaagaggtcatctttcattcaactcg
tggttttctaacggcacgactacttatgataacattgcctacactttaaggttaatggta
gattgtggaattgtcggtatgtcctggataacattaccaaaaggaaagtattcgatgatt
gagcctaataacagagtttcctcttgtcagttggaagtttcaattaattatcgtaaccta
atagcacatcctgctgagggtgattggtctcatacagctccattgcgtatcatgtccttt
gatatcgagtgtgctggtaggattggcgtctttccggaacctgaatacgatcccgtcatc
caaattgccaacgttgtgagtattgctggcgctaagaaaccattcattcgtaatgtgttt
actctgaatacatgctcacccataacaggttcaatgattttttcccacgccactgaagag
gaaatgttgagcaattggcgtaactttatcatcaaagttgatcctgatgttatcattggt
tataatactacaaattttgatatcccttatcttttaaaccgtgcaaaggcgctaaaggtg
aatgatttcccatattttggaaggttaaaaaccgttaagcaagaaattaaagagtctgtg
ttctcttcgaaggcttatggtacaagagaaaccaaaaatgtcaatattgacggccgatta
cagttggatcttttgcaatttattcagcgtgagtataaactaagatcctacacgttgaat
gcagtctctgcgcactttttaggtgaacagaaggaggatgtacattatagcatcatttct
gatctacaaaatggcgatagtgaaacaagaagaaggttggccgtttactgtttgaaagac
gcctacctgcctttaaggcttatggaaaaactaatggcgttagttaactatacagaaatg
gctcgtgttacaggtgtgccattttcatatttactagctcgtggtcaacaaattaaagtt
gtttctcaactatttcgaaagtgcctggagattgatactgtgatacctaacatgcaatct
caggcctctgatgaccaatatgagggtgccactgttattgagcctattcgtggttattac
gatgtaccgattgcaactttggatttcaattctttatatccaagtattatgatggcgcac
aacctatgttatacaacactttgtaacaaagctactgtagagagattgaatcttaaaatt
gacgaagactacgtcataacacctaatggagattattttgttaccacaaaaagaaggcgt
ggtatattaccaattattctggatgaattaataagtgctagaaaacgcgctaaaaaagat
ctgagagatgagaaggatccattcaaaagagatgttttaaatggtagacaattggctttg
aagatttcagctaactctgtctatggttttacaggagcgacggtgggtaaattgccatgt
ttagccatttcttcatctgttactgcttatggtcgtaccatgattttaaaaactaaaacc
gcagtccaagaaaaatattgtataaagaatggttataagcacgatgccgttgtggtttac
ggtgacactgattccgttatggtaaagtttggtacaacagatttaaaggaagctatggat
cttggtaccgaagctgccaaatatgtctccactctattcaaacatccgattaacttagaa
tttgaaaaagcatacttcccttaccttttgataaataaaaagcgttatgcaggtttattc
tggactaatcctgacaagtttgacaagttggaccaaaaaggccttgcttctgtccgtcgt
gattcctgttccttggtttctattgttatgaataaagttttaaagaaaattttaattgaa
agaaatgtagatggtgctttagcttttgtcagagaaactatcaatgatattctgcataat
agagtagatatttcaaagttgattatatcaaagacgttagccccaaattacacaaatcca
cagccgcacgccgttttggctgaacgtatgaagaggagagagggcgttggtccaaatgtt
ggtgatcgtgtggactatgtcattatcggtggtaatgataaactttacaatagagcagaa
gatccattatttgtactagaaaacaatattcaagtggattcgcgctattatttaactaat
caattacaaaatccaatcattagtattgttgcacctattattggcgacaaacaggcgaac
ggtatgttcgttgtgaaatccattaaaattaacacaggctctcaaaaaggaggcttgatg
agctttattaaaaaagttgaggcttgtaaaagttgtaaaggtccgttgaggaaaggtgaa
ggccctctttgttcaaactgtctagcaaggtctggagaattatacataaaggcattatac
gatgtcagagatttagaggaaaaatactcaagattatggacacaatgccaaaggtgcgct
ggtaacttacatagtgaagttttgtgttcaaataagaactgtgacattttttatatgcgg
gttaaggttaaaaaagagctgcaggagaaagtagaacaattaagcaaatggtaa

DBGET integrated database retrieval system