KEGG   Saccharomyces cerevisiae (budding yeast): YDL103CHelp
Entry
YDL103C           CDS       T00005                                 

Gene name
QRI1, UAP1
Definition
(RefSeq) UDP-N-acetylglucosamine diphosphorylase
  KO
K00972  UDP-N-acetylglucosamine/UDP-N-acetylgalactosamine diphosphorylase [EC:2.7.7.23 2.7.7.83]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00520  Amino sugar and nucleotide sugar metabolism
sce01100  Metabolic pathways
sce01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    YDL103C (QRI1)
Enzymes [BR:sce01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.23  UDP-N-acetylglucosamine diphosphorylase
     YDL103C (QRI1)
    2.7.7.83  UDP-N-acetylgalactosamine diphosphorylase
     YDL103C (QRI1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDPGP NTP_transf_3
Motif
Other DBs
NCBI-GeneID: 851455
NCBI-ProteinID: NP_010180
SGD: S000002261
UniProt: P43123
Position
IV:complement(275148..276581)
Genome map
AA seq 477 aa AA seqDB search
MTDTKQLFIEAGQSQLFHNWESLSRKDQEELLSNLEQISSKRSPAKLLEDCQNAIKFSLA
NSSKDTGVEISPLPPTSYESLIGNSKKENEYWRLGLEAIGKGEVAVILMAGGQGTRLGSS
QPKGCYDIGLPSKKSLFQIQAEKLIRLQDMVKDKKVEIPWYIMTSGPTRAATEAYFQEHN
YFGLNKEQITFFNQGTLPAFDLTGKHFLMKDPVNLSQSPDGNGGLYRAIKENKLNEDFDR
RGIKHVYMYCVDNVLSKIADPVFIGFAIKHGFELATKAVRKRDAHESVGLIATKNEKPCV
IEYSEISNELAEAKDKDGLLKLRAGNIVNHYYLVDLLKRDLDQWCENMPYHIAKKKIPAY
DSVTGKYTKPTEPNGIKLEQFIFDVFDTVPLNKFGCLEVDRCKEFSPLKNGPGSKNDNPE
TSRLAYLKLGTSWLEDAGAIVKDGVLVEVSSKLSYAGENLSQFKGKVFDRSGIVLEK
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgactgacacaaaacagctattcattgaagccggacaaagtcaacttttccacaattgg
gaaagcttgtctcgcaaagaccaagaagaattgctttcaaacctggagcaaatatcttcc
aagaggtcccctgcaaaactactggaagactgtcaaaatgctattaaattctcactagct
aactcttctaaggatactggcgtcgaaatttcaccattgccccctacttcgtacgagtcg
cttattggcaacagtaagaaagaaaatgaatactggcgtttaggccttgaagctattggc
aagggtgaagtcgcagtgattttaatggctggcggacaaggtacgcggttaggatcctct
caaccaaagggctgttacgacattggattgccttctaagaaatctctttttcaaattcaa
gctgaaaagttgatcaggttgcaagatatggtaaaggacaaaaaggtagaaattccttgg
tatattatgacatcaggccccactagagcggctactgaggcatactttcaagaacacaat
tattttggcttgaataaagaacaaattacgttcttcaaccagggaaccctgcctgccttt
gatttaaccgggaagcatttcctaatgaaagacccagtaaacctatctcaatcaccagat
ggaaatggtggactctaccgtgccatcaaggaaaacaagttgaacgaagactttgatagg
agaggaatcaagcatgtttacatgtactgtgtcgataatgtcctatctaaaatcgcagac
cctgtatttattggttttgccatcaagcatggcttcgaactggccaccaaagccgttaga
aagagagatgcgcatgaatcagttgggttaattgctactaaaaacgagaaaccatgtgtc
atagaatattctgaaatttccaatgaattggctgaagcaaaggataaagatggcttatta
aaactacgcgcaggcaacattgtaaatcattattacctagtggatttactaaaacgtgat
ttggatcagtggtgtgagaatatgccatatcacattgcgaagaagaaaattccagcttat
gatagtgttaccggcaagtacactaagcctaccgaaccaaacggtataaaattagagcaa
ttcatatttgatgtctttgacactgtaccactgaacaagtttgggtgcttagaagtagat
agatgcaaagaattttcacctttaaaaaacggtcctggttctaagaacgataatcctgag
accagcagactagcatatttgaaactaggaacctcgtggttggaagatgcaggcgctatt
gtaaaagatggggtactagtcgaagtttccagcaaattgagttatgcaggtgaaaatcta
tcccagttcaaaggtaaagtctttgacagaagtggtatagtattagaaaaataa

DBGET integrated database retrieval system