KEGG   Saccharomyces cerevisiae (budding yeast): YDL128WHelp
Entry
YDL128W           CDS       T00005                                 

Gene name
VCX1, HUM1, MNR1
Definition
(RefSeq) Vcx1p
  KO
K07300  Ca2+:H+ antiporter
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sce02000]
    YDL128W (VCX1)
Transporters [BR:sce02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   YDL128W (VCX1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_Ca_ex
Motif
Other DBs
NCBI-GeneID: 851429
NCBI-ProteinID: NP_010155
SGD: S000002286
UniProt: Q99385
Structure
PDB: 

Position
IV:232652..233887
Genome map
AA seq 411 aa AA seqDB search
MDATTPLLTVANSHPARNPKHTAWRAAVYDLQYILKASPLNFLLVFVPLGLIWGHFQLSH
TLTFLFNFLAIIPLAAILANATEELADKAGNTIGGLLNATFGNAVELIVSIIALKKGQVR
IVQASMLGSLLSNLLLVLGLCFIFGGYNRVQQTFNQTAAQTMSSLLAIACASLLIPAAFR
ATLPHGKEDHFIDGKILELSRGTSIVILIVYVLFLYFQLGSHHALFEQQEEETDEVMSTI
SRNPHHSLSVKSSLVILLGTTVIISFCADFLVGTIDNVVESTGLSKTFIGLIVIPIVGNA
AEHVTSVLVAMKDKMDLALGVAIGSSLQVALFVTPFMVLVGWMIDVPMTLNFSTFETATL
FIAVFLSNYLILDGESNWLEGVMSLAMYILIAMAFFYYPDEKTLDSIGNSL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaactaccccactattaactgttgcgaacagtcatcccgcccgcaatccaaag
cacactgcatggagagcagctgtgtatgatttacagtatattttgaaagcgtcacccctg
aatttcctattggtatttgttcctttaggtctgatttggggacacttccaactatctcat
acactgacatttctttttaatttcttggcaattataccgttggcagctatcttggctaat
gccacggaagagttggctgataaggctggtaacaccattgggggactgctaaatgctact
tttggtaacgctgtggaactaattgtttctatcattgccctgaaaaaaggtcaagtgaga
attgtgcaggcctcgatgctaggtagtcttctttctaatttgctgttagtgcttggatta
tgcttcatattcggtggatacaatagagtccaacagacattcaaccaaaccgccgctcaa
acaatgtcctcattacttgccattgcgtgtgcatccctactgattcccgctgcctttaga
gccaccctacctcatggcaaggaagaccacttcatcgatggaaaaatattggagttatcc
agaggcacctctattgttattctcatcgtttacgttttgttcttatatttccagctaggg
agccatcacgccttgtttgagcaacaagaagaagagaccgatgaagttatgagcaccatt
tccaggaatccacatcactctttgagtgtcaagtcatcattggtgatacttctaggtaca
actgtgatcatctctttttgtgcggattttctagtcggtacgatagacaacgttgttgaa
tctaccgggctatctaaaacatttataggtttgattgtcattcctattgtgggtaatgcc
gcagagcatgtcacttcagtcttggtggccatgaaggataagatggatctggcgctaggt
gttgccatcggttcctctttacaagttgccttatttgttacaccattcatggttcttgtg
ggctggatgatcgatgttccaatgacgctaaatttctccacttttgaaaccgctactctt
tttattgctgttttcttatccaattacttaattctcgatggtgagtcaaactggttggag
ggtgtcatgtctctagctatgtatattttgattgcaatggcatttttctattatccagac
gaaaaaacccttgactctattggaaatagtttatga

DBGET integrated database retrieval system