KEGG   Saccharomyces cerevisiae (budding yeast): YDL135C
Entry
YDL135C           CDS       T00005                                 

Gene name
RDI1
Definition
(RefSeq) Rdi1p
  KO
K12462  Rho GDP-dissociation inhibitor
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YDL135C (RDI1)
Exosome [BR:sce04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   YDL135C (RDI1)
  Exosomal proteins of other body fluids (saliva and urine)
   YDL135C (RDI1)
  Exosomal proteins of colorectal cancer cells
   YDL135C (RDI1)
SSDB
Motif
Pfam: Rho_GDI
Other DBs
NCBI-GeneID: 851420
NCBI-ProteinID: NP_010146
SGD: S000002294
UniProt: Q12434
Position
IV:complement(218680..219288)
AA seq 202 aa
MAEESTDFSQFEEERNNDQYKVSAKKTVDEYKNLDAEDESLAKWKESLGLSSDVLPLEFP
GDKRKVVVQKIQLLVNTEPNPITFDLTNEKTIKELASKRYKIKENSIYKLKIVFKVQHEI
ITGLRYVQYIKKAGIAVDKIDDHLGSYAPNTKTKPFYEVELPESEAPSGFLARGNYSAVS
KFIDDDKTNHLTLNWGVEIVKK
NT seq 609 nt   +upstreamnt  +downstreamnt
atggccgaagaaagtaccgactttagtcaattcgaagaggagagaaacaacgatcagtat
aaagtttcagccaaaaaaactgttgacgaatacaaaaatctggatgctgaagacgaatcc
ttggcgaaatggaaagagtctttgggtctaagttcagacgtcttgccattggaatttccc
ggtgacaaaaggaaggtggttgttcaaaaaattcaattactagtcaatacagaaccaaat
cctatcacatttgatcttaccaacgaaaagacaatcaaagaactggcatctaaaagatac
aaaattaaagaaaattctatttataagttgaagattgtgttcaaagttcaacatgaaatt
atcacagggttgcgatatgtccagtatatcaaaaaagcgggtattgccgttgacaagata
gacgatcatttgggatcgtatgctcctaataccaagaccaaaccattttatgaggtggaa
ctaccggaaagtgaagcacctagtgggtttttagcaagaggtaactacagtgccgtatca
aaattcattgatgatgataaaactaaccacttgactttaaattggggggtcgaaattgtc
aaaaaataa

DBGET integrated database retrieval system