KEGG   Saccharomyces cerevisiae (budding yeast): YDL168WHelp
Entry
YDL168W           CDS       T00005                                 

Gene name
SFA1, ADH5
Definition
(RefSeq) bifunctional alcohol dehydrogenase/S-(hydroxymethyl)glutathione dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00010  Glycolysis / Gluconeogenesis
sce00071  Fatty acid degradation
sce00350  Tyrosine metabolism
sce00680  Methane metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01130  Biosynthesis of antibiotics
sce01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YDL168W (SFA1)
  09102 Energy metabolism
   00680 Methane metabolism
    YDL168W (SFA1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    YDL168W (SFA1)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    YDL168W (SFA1)
Enzymes [BR:sce01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     YDL168W (SFA1)
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     YDL168W (SFA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C Sacchrp_dh_NADP TrkA_N
Motif
Other DBs
NCBI-GeneID: 851386
NCBI-ProteinID: NP_010113
SGD: S000002327
UniProt: P32771
Position
IV:159604..160764
Genome map
AA seq 386 aa AA seqDB search
MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD
PEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRA
TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG
VTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAIDINNKKKQYCSQF
GATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIII
GVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPF
KEINQAFEDLHNGDCLRTVLKSDEIK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgctactgttggtaaacctattaagtgcattgctgctgttgcgtatgatgcg
aagaaaccattaagtgttgaagaaatcacggtagacgccccaaaagcgcacgaagtacgt
atcaaaattgaatatactgctgtatgccacactgatgcgtacactttatcaggctctgat
ccagaaggacttttcccttgcgttctgggccacgaaggagccggtatcgtagaatctgta
ggcgatgatgtcataacagttaagcctggtgatcatgttattgctttgtacactgctgag
tgtggcaaatgtaagttctgtacttccggtaaaaccaacttatgtggtgctgttagagct
actcaagggaaaggtgtaatgcctgatgggaccacaagatttcataatgcgaaaggtgaa
gatatataccatttcatgggttgctctactttttccgaatatactgtggtggcagatgtc
tctgtggttgccatcgatccaaaagctcccttggatgctgcctgtttactgggttgtggt
gttactactggttttggggcggctcttaagacagctaatgtgcaaaaaggcgataccgtt
gcagtatttggctgcgggactgtaggactctccgttatccaaggtgcaaagttaaggggc
gcttccaagatcattgccattgacattaacaataagaaaaaacaatattgttctcaattt
ggtgccacggattttgttaatcccaaggaagatttggccaaagatcaaactatcgttgaa
aagttaattgaaatgactgatgggggtctggattttacttttgactgtactggtaatacc
aaaattatgagagatgctttggaagcctgtcataaaggttggggtcaatctattatcatt
ggtgtggctgccgctggtgaagaaatttctacaaggccgttccagctggtcactggtaga
gtgtggaaaggctctgcttttggtggcatcaaaggtagatctgaaatgggcggtttaatt
aaagactatcaaaaaggtgccttaaaagtcgaagaatttatcactcacaggagaccattc
aaagaaatcaatcaagcctttgaagatttgcataacggtgattgcttaagaaccgtcttg
aagtctgatgaaataaaatag

DBGET integrated database retrieval system