KEGG   Saccharomyces cerevisiae (budding yeast): YDL189WHelp
Entry
YDL189W           CDS       T00005                                 

Gene name
RBS1
Definition
(RefSeq) Rbs1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: R3H
Motif
Other DBs
NCBI-GeneID: 851338
NCBI-ProteinID: NP_010092
SGD: S000002348
UniProt: Q05672
Position
IV:122216..123589
Genome map
AA seq 457 aa AA seqDB search
MTALDSRNWGLTPAMETGLFQKPQDRIFIIELENSIVSFINSNTESFQLRPMNSYYRLLS
HQIAEYHNLNHVLARTQDSCVILFKGENFQKIEGKPLLQELQLNKKPEECASSSESIEKS
NNNRIFRILKRKEVGNECDYKIDGNTRTPNSNLTANSNKDQKIEIDDKSSTDLEQERIEK
ERLYEQRKQEIFDKLNKSEDDVKSTNSSGSSDSDNEWSDWLNGDDSNTQTSNGSVSSSSP
FNSSVTTIQVNKPQQQFYDSRRGRGGRRRGTNNYKDAYRGQSRRNKENGGYQSGYSSPYL
VYPPPQMGGNSLPTYPLMYNPAGPAPGPAPSPMVMGNNTVFMNPYMYNMNPQGSCSFGTP
IPMYPPYQYQYQYQYNTQYHSGPYSNTPSYNSNNYTRSSANKYHHFQGKNSYSGAIPKRS
DDSNSNKNEGIRRASVEGSPSSRDTDSVEMKFDKLNI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgacagcactagattctcgaaactggggattgacacccgctatggaaacgggcttgttc
cagaaaccacaggaccgtatctttataatagagctggaaaattccatagtgtcattcata
aactcaaacacagaatcatttcagctaagaccgatgaattcatattataggcttctatcg
caccaaatagctgagtaccacaacttgaaccatgttttggcaagaactcaagatagttgt
gtgattcttttcaaaggtgagaatttccaaaagattgaaggaaagccactcttacaagag
ttgcagctgaacaaaaaaccggaagagtgtgcttcctcaagtgagagtattgaaaaatcg
aacaataacagaatatttcgaatcttaaagcggaaagaggtaggtaacgagtgcgattat
aaaatcgatggcaatacacgtacaccaaatagcaatttgacagccaattcaaataaggac
caaaaaatcgaaatcgatgataaatctagtactgatttggaacaagaaagaattgagaag
gaaagactttatgaacaacgtaaacaagaaatttttgataagctcaacaagagtgaagac
gatgtaaagtcaaccaacagtagcggtagtagtgatagtgacaatgaatggagtgattgg
ttgaacggagatgactctaacacacaaactagtaacggttcagttagctcttcatcacca
ttcaattcatctgtgacgacgatacaagtaaacaaacctcaacaacaattttatgatagt
cgaagaggaagaggaggaagaagaagaggaacaaacaattacaaagatgcctatagaggc
caaagtcgtcggaataaagaaaacggcggttaccaatcgggatattcttcgccatatctt
gtgtatcctcctccccaaatgggtggcaatagtctgccaacctaccctctaatgtataac
cccgctggtcctgcccccggtcctgcaccttcacccatggtaatgggcaataacacagtc
ttcatgaacccttacatgtacaatatgaatccccaagggtcctgttcgtttggcacccca
atccctatgtatcccccataccaatatcaatatcaataccaatataacactcagtatcac
agcgggccatatagcaatacaccaagctataattctaacaattacacaagatcctcagca
aataagtaccaccattttcaaggaaaaaattcatattctggtgcgattccgaaacgtagt
gatgacagtaacagtaataagaatgagggaattcgtagggctagtgttgagggttcgccg
tcatctagggatactgattcggtagagatgaaatttgataaattaaacatttag

DBGET integrated database retrieval system