KEGG   Saccharomyces cerevisiae (budding yeast): YDL190CHelp
Entry
YDL190C           CDS       T00005                                 

Gene name
UFD2
Definition
(RefSeq) ubiquitin-ubiquitin ligase UFD2
  KO
K10597  ubiquitin conjugation factor E4 B [EC:2.3.2.27]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04120  Ubiquitin mediated proteolysis
sce04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sce00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    YDL190C (UFD2)
   04120 Ubiquitin mediated proteolysis
    YDL190C (UFD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sce04121]
    YDL190C (UFD2)
Enzymes [BR:sce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     YDL190C (UFD2)
Ubiquitin system [BR:sce04121]
 Ubiquitin ligases (E3)
  U-box type E3
   YDL190C (UFD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ufd2P_core U-box
Motif
Other DBs
NCBI-GeneID: 851337
NCBI-ProteinID: NP_010091
SGD: S000002349
UniProt: P54860
Structure
PDB: 

Position
IV:complement(118707..121592)
Genome map
AA seq 961 aa AA seqDB search
MTAIEDILQITTDPSDTRGYSLLKSEEVPQGSTLGVDFIDTLLLYQLTENEKLDKPFEYL
NDCFRRNQQQKRITKNKPNAESLHSTFQEIDRLVIGYGVVALQIENFCMNGAFINYITGI
VSNVNSYTDFLSQIIQRAILEGTALDLLNAVFPTLLEYCNKHVSHFDLNESVIYNNVLTI
FELFVTFKPIAEIFTKIDGFFADYSCKPQDFERKTILGPILSLSPIEAAVAIRNYGDNLL
RSKQQTAMIHESLQAEHKVVIDRLFFIVDKLVRGSLNSRTDMISYFAHIANKNHLRRADH
PPFKELSSNGFMSNITLLLVRFSQPFLDISYKKIDKIDANYFNNPSLFIDLSGETRLNSD
FKEADAFYDKNRKTADSKPNFISDCFFLTLTYLHYGLGGTLSFEEKMGSEIKALKEEIEK
VKKIAANHDVFARFITAQLSKMEKALKTTESLRFALQGFFAHRSLQLEVFDFICGASTFL
IRVVDPEHEFPFKQIKLPLIPDQIGVENVDNADFLRAHAPVPFKYYPEFVVEGPVNYSLY
ISKYQTSPIFRNPRLGSFVEFTTMVLRCPELVSNPHLKGKLVQLLSVGAMPLTDNSPGFM
MDIFEHDELVNKNLLYALLDFYVIVEKTGSSSQFYDKFNSRYSISIILEELYYKIPSYKN
QLIWQSQNNADFFVRFVARMLNDLTFLLDEGLSNLAEVHNIQNELDNRARGAPPTREEED
KELQTRLASASRQAKSSCGLADKSMKLFEIYSKDIPAAFVTPEIVYRLASMLNYNLESLV
GPKCGELKVKDPQSYSFNPKDLLKALTTVYINLSEQSEFISAVAKDERSFNRNLFVRAVD
ILGRKTGLASPEFIEKLLNFANKAEEQRKADEEEDLEYGDVPDEFLDPLMYTIMKDPVIL
PASKMNIDRSTIKAHLLSDSTDPFNRMPLKLEDVTPNEELRQKILCFKKQKKEEAKHKAS
E
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccatagaagatattttacaaatcaccaccgatccttccgatacccgtggctac
tctctattgaagtccgaggaagtgcctcaaggctcaactcttggagttgattttattgat
acgctactattatatcaactcaccgagaatgagaagttggataaaccgtttgaatatttg
aacgattgctttcgccgtaatcagcaacaaaaaagaatcaccaaaaacaagccaaatgct
gagtcattacattccactttccaagagattgatcgtcttgtcattggctatggtgtcgtt
gccttacaaatagaaaacttttgcatgaatggtgctttcatcaattatatcactggaatt
gtttctaacgttaactcatatactgatttcctttcccaaatcattcaaagagccatatta
gaaggtaccgctttggatttacttaacgctgttttcccgacattattagaatactgtaat
aaacatgtcagccattttgatttgaacgaatctgtaatttacaataacgttcttaccatt
tttgagttatttgttacatttaaacctattgcagaaatattcactaaaatagatggtttt
tttgcagactatagctgtaaaccacaggattttgaaaggaaaacgatattggggcctatt
ttatctctttctcccatagaagctgctgtggcaatccggaactacggcgataaccttttg
cgttccaaacaacagacagccatgatccatgaatctctacaagctgagcataaagttgtc
atagatagactcttttttattgtcgataagcttgttcgtggctccttaaactcaaggact
gatatgattagttattttgcccatatcgctaataaaaaccatttacgtagagccgatcat
ccaccattcaaagaactatcctctaacggatttatgtccaatatcactttgttattggtt
agattttctcaaccatttctagatatttcatataagaaaatcgacaagatcgacgcaaat
tacttcaacaacccaagtttatttattgatttatcaggggaaacacgattaaattctgat
tttaaagaggcagatgcattttatgacaagaacagaaaaacagcagattctaagccaaac
ttcatctctgattgctttttcttgacattaacctatttgcattatggtctgggaggtaca
ttatcatttgaagagaagatgggatctgaaatcaaagcgttaaaggaagaaattgaaaaa
gtaaagaaaatagctgcgaaccacgatgtctttgccagattcattacagcacaattatcc
aagatggagaaggcgttgaaaacaacagaatctttgcgatttgctcttcaagggttcttc
gctcatagatctcttcaactagaggttttcgactttatttgtggtgcatctacgttcttg
attcgtgttgtggatcctgaacacgaatttccgtttaaacaaattaaattgccattaatt
ccggaccaaataggtgttgaaaacgtggacaacgctgattttttgagagcgcatgctcca
gtgccttttaaatactatccagaatttgttgtagaaggtccagttaactattctctatac
atttcgaagtaccagacctctccaatcttcagaaatccacgtctgggatcgtttgttgag
tttacaacaatggtcctccgttgtcctgaattggtttccaacccacatttaaaaggtaaa
ttagtgcagttattaagcgttggtgctatgcctctaacagacaattcccccggattcatg
atggatatattcgaacacgacgaattagttaacaagaatctgttatatgctctactagac
ttttatgttattgttgaaaaaacaggctcttcttcacaattttacgataaattcaacagc
agatatagcatatcaataattttggaggagctttattacaagataccatcttataaaaac
caattgatctggcagtctcaaaacaatgctgacttttttgtgaggttcgttgctcgtatg
ttgaatgacttgactttcctgttggatgaaggcctaagtaatttggctgaggtgcataat
atccaaaatgagctggataatcgtgcaaggggcgcgccaccaacaagagaggaagaggac
aaagaactacaaacaagattggcgtctgcttccaggcaagctaagtcctcgtgtggattg
gccgataaatcgatgaaactgttcgaaatctattcgaaggatataccggctgcatttgtc
acaccagaaatcgtatatagactggcaagtatgctaaactataacttagagtcacttgtc
ggtcccaaatgcggggaactaaaagtgaaagacccacaaagttattcattcaacccaaaa
gatttgttgaaagccttaacaactgtttatatcaatctttccgagcaatcagagttcatc
agtgctgtcgctaaagatgaaagatcatttaatagaaatctctttgttcgcgcagttgat
attcttggtagaaaaactggtttagcatctccagagttcatcgaaaaactattgaacttt
gccaataaagccgaagagcaaagaaaggctgatgaagaggaagatcttgagtatggtgat
gttcctgacgagttcttagatcctttgatgtacacaattatgaaggatcctgtcatttta
ccagcatccaagatgaatattgatagaagcacgatcaaagcacatctgcttagtgactct
actgacccgtttaatagaatgcctttaaaactagaggatgtaacacctaatgaagagtta
aggcaaaagattctttgtttcaaaaaacaaaaaaaggaagaagcaaaacataaagcaagc
gagtga

DBGET integrated database retrieval system