KEGG   Saccharomyces cerevisiae (budding yeast): YDL192WHelp
Entry
YDL192W           CDS       T00005                                 

Gene name
ARF1
Definition
(RefSeq) Arf family GTPase ARF1
  KO
K07937  ADP-ribosylation factor 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    YDL192W (ARF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YDL192W (ARF1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sce04147]
    YDL192W (ARF1)
   04031 GTP-binding proteins [BR:sce04031]
    YDL192W (ARF1)
Membrane trafficking [BR:sce04131]
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    YDL192W (ARF1)
  Arf GTPases and associated proteins
   Arf GTPases
    YDL192W (ARF1)
 Endosome - Golgi transport
    YDL192W (ARF1)
Exosome [BR:sce04147]
 Exosomal proteins
  Proteins found in most exosomes
   YDL192W (ARF1)
GTP-binding proteins [BR:sce04031]
 Small (Monomeric) G-proteins
  Arf/Sar Family
   Arf [OT]
    YDL192W (ARF1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arf Roc Ras SRPRB G-alpha Gtr1_RagA MMR_HSR1 SRP54 AAA_33 ABC_tran GTP_EFTU 6PF2K AAA_18 Thymidylate_kin
Motif
Other DBs
NCBI-GeneID: 851335
NCBI-ProteinID: NP_010089
SGD: S000002351
UniProt: P11076
Structure
PDB: 

Position
IV:116321..116866
Genome map
AA seq 181 aa AA seqDB search
MGLFASKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVITTIPTIGFNVETVQYKN
ISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAA
WLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQATCATSGEGLYEGLEWLSNSLKNS
T
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgggtttgtttgcctctaagttgttcagtaacctttttggtaacaaagaaatgcgtatt
cttatggttggtcttgatggtgctggtaagaccaccgttttgtacaagttgaaattgggt
gaagttatcactaccattccaacaattggtttcaacgttgaaactgtccaatataagaac
atttcattcactgtctgggatgtcggtggacaagacagaattagatctctatggagacac
tactacagaaacactgaaggtgttatctttgttgtcgattctaacgatagatcgcgtatt
ggtgaagctagagaagttatgcaaagaatgttgaacgaagatgaattgagaaacgccgct
tggttggtgttcgctaacaagcaagatttgccagaagccatgtctgctgctgaaatcact
gaaaaactaggtttacattctattagaaaccgtccatggtttatccaagccacgtgtgct
acctccggtgaaggtttgtatgaaggtttggaatggttaagtaacagtttgaaaaactca
acttaa

DBGET integrated database retrieval system