KEGG   Saccharomyces cerevisiae (budding yeast): YDL198CHelp
Entry
YDL198C           CDS       T00005                                 

Gene name
GGC1, SHM1, YHM1
Definition
(RefSeq) Ggc1p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mito_carr
Motif
Other DBs
NCBI-GeneID: 851329
NCBI-ProteinID: NP_010083
SGD: S000002357
UniProt: P38988
Position
IV:complement(103649..104551)
Genome map
AA seq 300 aa AA seqDB search
MPHTDKKQSGLARLLGSASAGIMEIAVFHPVDTISKRLMSNHTKITSGQELNRVIFRDHF
SEPLGKRLFTLFPGLGYAASYKVLQRVYKYGGQPFANEFLNKHYKKDFDNLFGEKTGKAM
RSAAAGSLIGIGEIVLLPLDVLKIKRQTNPESFKGRGFIKILRDEGLFNLYRGWGWTAAR
NAPGSFALFGGNAFAKEYILGLKDYSQATWSQNFISSIVGACSSLIVSAPLDVIKTRIQN
RNFDNPESGLRIVKNTLKNEGVTAFFKGLTPKLLTTGPKLVFSFALAQSLIPRFDNLLSK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcctcataccgataagaaacaatcaggattagctcgtcttttggggtccgcctctgca
ggcataatggaaattgccgtcttccatcctgtggacaccatttccaaaagactgatgtcc
aaccacaccaaaataacctctggccaggaattgaatcgtgttatttttcgtgatcatttc
agcgaacctttgggcaaacgtttgtttaccttgttcccgggtctcggttacgctgcatca
tacaaagttcttcaaagagtgtataaatatggtggtcagccttttgctaacgagtttttg
aataagcactacaaaaaggattttgataatcttttcggtgaaaagactggtaaggcaatg
agatccgccgctgctggatctttgattggtattggtgaaattgttcttttgccgctggac
gtgttgaagattaagagacagaccaatcccgaatcgtttaaaggtagaggtttcatcaag
attttgagagacgaaggcctgttcaacttatataggggttgggggtggacggctgccaga
aatgctcccggttcattcgccctttttggtggtaatgcattcgccaaggagtatatcttg
ggtttgaaagattattctcaagctacttggtcccaaaacttcatctcctccatcgtcggt
gcttgctcctctctgatcgtttctgctccattagatgtcatcaagacaagaattcaaaat
aggaattttgataatcctgaaagcgggttgagaatcgtcaaaaacactctgaaaaatgaa
ggtgtaactgcgtttttcaagggcttaacacctaaattactaacaacgggtccaaaactg
gttttctcatttgcgttagctcaatctttgatacctagattcgataacctgttgagcaaa
tga

DBGET integrated database retrieval system