KEGG   Saccharomyces cerevisiae (budding yeast): YDL199CHelp
Entry
YDL199C           CDS       T00005                                 

Definition
(RefSeq) hypothetical protein
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 Leptin
Motif
Other DBs
NCBI-GeneID: 851328
NCBI-ProteinID: NP_010082
SGD: S000002358
UniProt: Q12407
Position
IV:complement(101290..103353)
Genome map
AA seq 687 aa AA seqDB search
MKPPLNMSRSNKPLTQEANSSAHIDRAHQLAQDFNSKQDDTALTSLPHKNPDIFRFENNI
TAHSSRRGSLYRDSDATVVLPLSEHTPRLSMDDPYRQLLQQAEISQLRSKKKRHSSRVLR
TSFISFVVLVSSLSGLDQGLISGNVMTLSFQKYFHYPLTSPLGNIVSIVNLGAFMASLFV
YSGILEPCSRKKMLQISTMIYSLGAIVQVLALNQWCLLLGRFLLGVGMGFAFSMVIIYQF
EFPLPCIRKRTLISIQCVSSVIAYSFGIWINCAFRYLGFAWRYPLSTHVALGIILNLMSF
YLILESPSWLLKQKNDVEALVLISNVFDDGNFEENQTQLKFRVLKRDILLKSHLQKNSYP
YAYILKDFSSIIKLLIGFQLLTRTNGVDAFLYYSPLILQQMGRGERKSIYLTGLNALIYS
IVILAYVPLVLRKRKEKTNVLLGSIVMCALLFTISFTDWFPKSTTRYISILFAVFLFTHF
ISWDSIGWVMTIELLPHLSQAPVILLVSNFYWIFKWFVSLITPILIDRLSWKFYLIPSLS
SFISIIFVLKIFPIETRDERLDSDDDSTGNGSGNHDDVFDDTGSEFSSSPSFSAYQINTL
GSSIKQNNQAYSSIQNEQILPKNGNLSNQTHGSAQNVYFITSDSGPSRTGEFFSFHNRTD
PNISDNIAANKPSSGGGQNSPGDMAVA
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctccgttaaacatgtcacgttcaaataaaccacttactcaggaagctaatagt
tcggcgcatattgatagggcacatcagctagcacaggattttaacagtaaacaggatgat
accgcactaacttcactgccccacaagaaccccgacatattcagatttgagaacaacatc
acagctcatagctcgcgtcgtggttctctatatagagacagcgatgctactgtggttttg
ccgctttctgaacatacccctagattatcaatggatgatccataccgccaattactacaa
caggctgaaatctcacaactacgaagtaagaaaaaaaggcattccagtcgagttttgcgt
acttcgtttatatcttttgtggtgctagtttcctcgctgtcagggttggaccaaggcctc
atatctggtaacgttatgactttgtcgttccagaagtattttcattacccacttacttct
ccgctgggcaatatagtgagcattgttaatctgggtgcgttcatggcgtcgttatttgtc
tattctggcatcctggagccttgtagcaggaaaaaaatgctccaaataagcacaatgata
tactctttgggtgccattgttcaggtcttggctctaaaccaatggtgtttactactgggt
agattcttactcggagtaggtatgggctttgccttttctatggtaataatttatcaattc
gagtttccccttccctgtataagaaaacggacattaatttccattcaatgcgtctctagt
gtcattgcgtattcattcggaatatggattaattgtgctttcagatatttgggctttgca
tggagataccctttgtcaacacatgtggcacttggaataatactaaacctaatgtcgttc
tatcttattttagagtccccttcgtggctgttgaagcaaaagaacgacgtagaggcattg
gttttaatatcgaatgttttcgatgatggaaatttcgaagaaaaccaaactcagttgaaa
tttagggtcctgaaacgagacatattattaaagtcacaccttcaaaaaaactcctatcca
tatgcgtatatcttaaaggatttttcttcaataataaaattgttgataggtttccaactt
ctcacacgaacaaatggagtggatgctttcttgtattactcaccgttaatattacaacaa
atggggagaggagaaagaaaatctatctatttaacggggcttaatgctttaatttacagc
atcgtaatattagcatatgttcccttggtgttacggaaacgtaaagagaaaacgaatgta
ctcttaggttcgattgtgatgtgtgcattgctatttaccatatcttttacagactggttt
cccaagagcacaacgaggtatatatcaatactatttgctgtttttctttttacgcacttc
atcagttgggattctataggatgggttatgaccattgagcttctacctcacttgtcacag
gccccagtgatactactagtctcaaacttttattggatttttaagtggttcgtcagctta
ataacccctatacttattgaccgtctgtcttggaagttttatcttattccatctttatct
tcctttatttccattatatttgtgctgaagatttttcctatagaaacccgtgacgaaagg
ttagattctgatgatgattctaccggaaacggtagcggtaaccatgatgatgtttttgac
gataccggttctgaattctcctcctcaccatctttttccgcgtatcagataaacactcta
ggaagtagtatcaaacaaaataatcaagcctattcatctattcaaaatgagcagattcta
cccaaaaacggaaacttatcgaaccagacacacggttctgcacaaaatgtttatttcatt
acatctgattcaggaccatcaaggactggagaatttttcagttttcataacagaaccgat
ccaaatatcagcgacaacattgctgcgaataaacccagttcaggtggaggccagaattcg
cctggagacatggcagttgcctag

DBGET integrated database retrieval system