KEGG   Saccharomyces cerevisiae (budding yeast): YDL205C
Entry
YDL205C           CDS       T00005                                 

Gene name
HEM3, OLE2
Definition
(RefSeq) hydroxymethylbilane synthase
  KO
K01749  hydroxymethylbilane synthase [EC:2.5.1.61]
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce00860  Porphyrin and chlorophyll metabolism
sce01100  Metabolic pathways
sce01110  Biosynthesis of secondary metabolites
sce01240  Biosynthesis of cofactors
Module
sce_M00868  Heme biosynthesis, animals and fungi, glycine => heme
Brite
KEGG Orthology (KO) [BR:sce00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    YDL205C (HEM3)
Enzymes [BR:sce01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.61  hydroxymethylbilane synthase
     YDL205C (HEM3)
SSDB
Motif
Pfam: Porphobil_deam Porphobil_deamC Phytochelatin_C
Other DBs
NCBI-GeneID: 851322
NCBI-ProteinID: NP_010076
SGD: S000002364
UniProt: P28789
Position
IV:complement(92762..93745)
AA seq 327 aa
MGPETLHIGGRKSKLAVIQSNHVLKLIEEKYPDYDCKVFTLQTLGDQIQFKPLYSFGGKA
LWTKELEDHLYHDDPSKKLDLIVHSLKDMPTLLPEGFELGGITKRVDPTDCLVMPFYSAY
KSLDDLPDGGIVGTSSVRRSAQLKRKYPHLKFESVRGNIQTRLQKLDDPKSPYQCIILAS
AGLMRMGLENRITQRFHSDTMYHAVGQGALGIEIRKGDTKMMKILDEICDLNATICCLSE
RALMRTLEGGCSVPIGVESKYNEETKKLLLKAIVVDVEGTEAVEDEIEMLIENVKEDSMA
CGKILAERMIADGAKKILDEINLDRIK
NT seq 984 nt   +upstreamnt  +downstreamnt
atgggccctgaaactctacatattggtgggagaaaatcgaaattggcggtaatacaatcc
aaccatgttttaaaactgatcgaagaaaagtatccggactacgactgcaaggttttcact
ttgcaaactcttggtgaccagattcaattcaaacctttgtactcatttggcggtaaagct
ttatggacaaaggagttggaagaccatctttaccatgacgatccctcaaagaagcttgac
ttgatcgttcattctctgaaggacatgcccactttactaccagagggtttcgagctgggg
ggtatcactaagcgggtcgatccaacagattgtcttgtcatgcccttttactctgcttat
aagtctctggatgaccttccagacggggggattgtgggaacctcatccgtgagaagatct
gctcagctaaaaagaaaatacccacatttgaaatttgaaagtgtcagaggaaatatacaa
actagattacaaaaactagacgacccaaaatctccgtaccaatgcatcatcttggcgtct
gctgggttgatgcgtatggggttggaaaacagaattacgcagcgattccattcggataca
atgtaccatgcagttggacaaggcgccctgggtatagaaattagaaagggtgacaccaag
atgatgaagattcttgacgaaatttgcgatctaaatgcaactatatgttgcctttcggag
cgtgctttgatgagaactttagaggggggttgttccgttcctattggtgtggaatctaaa
tacaatgaagagactaaaaaattactattaaaggccattgtagttgacgttgaaggcaca
gaagcagtagaagacgaaattgaaatgctaatagaaaatgttaaagaagattccatggcg
tgtggtaagatactagctgaaagaatgattgccgatggcgcaaagaaaattctggatgaa
attaatttagacagaatcaaatga

DBGET integrated database retrieval system