KEGG   Saccharomyces cerevisiae (budding yeast): YDL224CHelp
Entry
YDL224C           CDS       T00005                                 

Gene name
WHI4
Definition
(RefSeq) Whi4p
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RRM_1
Motif
Other DBs
NCBI-GeneID: 851302
NCBI-ProteinID: NP_010057
SGD: S000002383
UniProt: Q07655
Position
IV:complement(54397..56346)
Genome map
AA seq 649 aa AA seqDB search
MSLVHNQTNLNESKFLIERAFSSSSETVPLSKEATYPMPTAYSFSAVRSNSETNIKRENP
QGFAKEPIMTSMLHNLTMSTGKGNGNDVNSLAPHDVDVGPYCLLLRNLPKDITLRECYCI
FSLATGVSSIELKRDDREPFNDNEKVVVVKFGSLSLVTHYANILNSKSEIFGPSFPFRSH
IDVVNEQTQLPVSFQEHVSSGTTNSSPKNYQLSSSAQNEIQNQSFNTISYGKTSSSPLGP
SAAKPRPSLLSERSLRFSFNDPFGLETISQRKESVPFLRNSISQHDLSNVTTTPVPAGMP
PQKDAGKSLLLLEKDEINESIWNGDELVNDVGNSSFGASLQEPPMSSTPVMEWNASSTAN
IPLFQLSSQENHQSNLLPPSHHSISQDVPHIQSQPNLNNSGVIHSATSLPHYHLLNQINA
STKTQSIQQSVSNVPSNLDLNLQTENGHPQSSAPNGSSIFNNQKVNQGFLVSEQDTSTIS
RQKECSSTASASAFSKNNETNVAGSTTISQADLSLLAKVPPPANPADQNPPCNTLYVGNL
PPDATEQELRQLFSNQQGFRRLSFRNKMNSHGHGNGHGHGPICFVEFEDVSFATRALAEL
YGSQLPHPRPSLNNKGGIRLSFSKNPLGVRGSNSRSKSGYSFNGSYGKS
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtcattagtgcataatcagacgaatttaaacgaatccaaatttcttatagaaagggca
tttagttctagttcagaaaccgttccattatcaaaggaggcaacatatcccatgccaact
gcatatagtttttccgcagttaggagcaacagcgagactaacattaaaagagagaacccg
caaggttttgcaaaagaacctattatgacttctatgcttcataatttgaccatgtccacg
gggaaagggaacgggaatgacgtcaattctttagccccacatgatgtggatgttggcccc
tactgtcttttgctgaggaatttgccaaaagacattacactaagagagtgttattgtata
ttttcactagcaactggggtgtcaagtatagaactaaaaagggatgatagagaacccttt
aatgacaatgaaaaagtcgttgtggtcaaatttggatccctttctttagtaacccattat
gctaatatattaaactcgaagtctgagatttttgggcctagtttcccctttaggtctcac
attgacgtagtaaatgaacaaacgcagcttccagtgagttttcaagaacatgtttcatct
ggcactacaaatagttctccaaagaattaccaattgtcgtccagtgcgcaaaatgaaatt
caaaatcaaagttttaatactatatcatatggaaaaactagttcctctccattagggcct
tcagcggccaagccaaggccttcattactttcagagagatccctccgtttctcattcaat
gacccattcggattggaaacaatctctcaaagaaaagaatccgtaccctttctacgaaat
agcatctcacaacatgatttatcaaacgtaaccaccacaccagttccagcaggaatgcca
cctcagaaggacgctggcaagtcacttttgctactagaaaaggatgaaataaatgaaagt
atttggaatggtgatgaattagttaatgatgttggtaattcttcatttggtgcatcttta
caagagcctccgatgtcatctacgcctgtgatggagtggaatgcttcctcaactgctaat
attcctctttttcaattatctagccaagaaaatcatcagtctaatctgttgcctccatcc
caccattcaattagccaggatgttccacatattcaatcacaacctaatctgaacaattca
ggagtaatacattccgcgacttctctaccgcattatcacttattgaaccaaattaatgct
tcaactaagacacaaagtattcagcagagcgtttcgaatgttccttccaatttggacctg
aatctccaaacggaaaatggccacccacaatcttctgctcctaacgggtcttcaatattc
aacaaccaaaaggtgaatcaaggctttttagtgagtgaacaagacaccagtacaatatca
cgacagaaagaatgttcttctacagcttctgcctctgcattttcgaaaaataacgaaaca
aatgtggcaggttccacaactatttcacaggctgacctatcactactagccaaggtgcca
ccaccagccaatcccgcggaccaaaatcctccttgtaatactctttatgtgggtaatcta
cctccggatgccacggaacaagaattaaggcaattgttttctaatcagcaaggttttcgt
agattatccttcaggaataaaatgaactctcacggtcatggcaacggtcatggccatggt
ccaatttgttttgtagaatttgaggatgttagctttgccactagagcattggcagaatta
tatggtagtcaactacctcacccccgcccttccctcaacaacaaaggaggtatcaggttg
agcttctctaaaaatccattaggcgttagaggctcaaacagtaggagtaaatctggttac
agctttaatggaagttacgggaaatcatga

DBGET integrated database retrieval system