KEGG   Saccharomyces cerevisiae (budding yeast): YDL225WHelp
Entry
YDL225W           CDS       T00005                                 

Gene name
SHS1, SEP7
Definition
(RefSeq) septin SHS1
  KO
K16946  seventh homolog of septin 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Brite
KEGG Orthology (KO) [BR:sce00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sce04812]
    YDL225W (SHS1)
Cytoskeleton proteins [BR:sce04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 3
     YDL225W (SHS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Septin AAA_7 AAA_22 AAA_24 AAA_33 Synaptobrevin AIG1 AAA Pox_A32 RNA_helicase AAA_16 AAA_18
Motif
Other DBs
NCBI-GeneID: 851373
NCBI-ProteinID: NP_010056
SGD: S000002384
UniProt: Q07657
Position
IV:52445..54100
Genome map
AA seq 551 aa AA seqDB search
MSTASTPPINLFRRKKEHKRGITYTMLLCGPAGTGKTAFANNLLETKIFPHKYQYGKSNA
SISSNPEVKVIAPTKVVSFNSKNGIPSYVSEFDPMRANLEPGITITSTSLELGGNKDQGK
PEMNEDDTVFFNLIMTHGIGENLDDSLCSEEVMSYLEQQFDIVLAEETRIKRNPRFEDTR
VHVALYFIEPTGHGLREVDVELMKSISKYTNVLPIITRADSFTKEELTQFRKNIMFDVER
YNVPIYKFEVDPEDDDLESMEENQALASLQPFAIITSDTRDSEGRYVREYPWGIISIDDD
KISDLKVLKNVLFGSHLQEFKDTTQNLLYENYRSEKLSSVANAEEIGPNSTKRQSNAPSL
SNFASLISTGQFNSSQTLANNLRADTPRNQVSGNFKENEYEDNGEHDSAENEQEMSPVRQ
LGREIKQENENLIRSIKTESSPKFLNSPDLPERTKLRNISETVPYVLRHERILARQQKLE
ELEAQSAKELQKRIQELERKAHELKLREKLINQNKLNGSSSSINSLQQSTRSQIKKNDTY
TDLASIASGRD
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgcttcaacaccgccaattaacttatttcgtagaaagaaagaacataaacgt
gggatcacatacacaatgttactatgtgggccagcaggtacaggaaagaccgcctttgct
aacaatctattggaaactaagatctttccgcataagtatcaatacggtaaatcaaatgct
agtattagctctaacccagaagtaaaagttattgctccgacaaaagttgtttcatttaat
tcgaaaaatgggattccatcttatgtttctgaattcgatccaatgagagccaatttggaa
ccaggtattaccatcacctccacttcattagaacttgggggcaacaaagatcaaggaaag
ccagaaatgaacgaggatgataccgtgtttttcaacttgattatgacgcatggtataggc
gaaaacttggacgattcgttgtgttctgaggaagttatgtcgtatttagaacaacaattt
gacattgttttagctgaggaaaccagaattaaaaggaatccgaggtttgaggacaccagg
gttcacgtagcattatattttattgaacccactggacacggtctgagagaagtcgatgta
gagctcatgaaaagcatctccaaatacacaaatgtactgccaataataacaagagctgac
tcattcaccaaggaggagctaactcaattcaggaaaaatattatgtttgatgtggaaaga
tacaacgtcccaatttacaaatttgaggttgaccctgaagatgatgatttggaatccatg
gaagagaatcaagccttggcatccttgcaaccatttgctattataacttcagataccaga
gatagtgaaggtagatacgttagggagtatccgtgggggataatatcaatcgacgacgac
aaaatttcggatttgaaagttttaaaaaacgtcctgtttggttctcacttacaagaattc
aaagacaccacgcaaaatttgctttacgagaattaccgttccgaaaaactatcgtccgtg
gccaacgctgaagaaattggtcctaattctacaaagagacagtcaaatgctccaagttta
agcaactttgcctctttgataagcactggtcaattcaattcttctcaaactcttgcaaac
aatttgagagcggacacaccaagaaaccaagtaagtggaaactttaaggaaaacgaatac
gaagacaatggcgaacatgattcagcagaaaatgaacaggaaatgtctcccgtgagacag
ttgggtagagaaataaaacaagaaaatgaaaatttgataagatctatcaaaacagaatct
tcaccaaaattcttgaactctccggacttaccagagcgtaccaagttaagaaatatttca
gaaaccgttccatatgtcttgagacatgaaagaattttagcaagacaacaaaaactggaa
gagttagaggcccagtcagctaaagaattacaaaaaagaattcaagaattagaaagaaaa
gcacacgaattgaaattgagggaaaaactaataaatcagaataaactaaacggttcatca
tcttcaatcaattctctacaacagagcacaaggagccaaattaaaaaaaatgacacgtat
actgatttagcctctattgcatcgggtagagattga

DBGET integrated database retrieval system