KEGG   Saccharomyces cerevisiae (budding yeast): YDL226CHelp
Entry
YDL226C           CDS       T00005                                 

Gene name
GCS1
Definition
(RefSeq) Gcs1p
  KO
K12492  ADP-ribosylation factor GTPase-activating protein 1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
Pathway
sce04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:sce00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    YDL226C (GCS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sce04131]
    YDL226C (GCS1)
Membrane trafficking [BR:sce04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    YDL226C (GCS1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArfGap PHA_synth_III_E
Motif
Other DBs
NCBI-GeneID: 851372
NCBI-ProteinID: NP_010055
SGD: S000002385
UniProt: P35197
Position
IV:complement(51115..52173)
Genome map
AA seq 352 aa AA seqDB search
MSDWKVDPDTRRRLLQLQKIGANKKCMDCGAPNPQWATPKFGAFICLECAGIHRGLGVHI
SFVRSITMDQFKPEELLRMEKGGNEPLTEWFKSHNIDLSLPQKVKYDNPVAEDYKEKLTC
LCEDRVFEEREHLDFDASKLSATSQTAASATPGVAQSREGTPLENRRSATPANSSNGANF
QKEKNEAYFAELGKKNQSRPDHLPPSQGGKYQGFGSTPAKPPQERSAGSSNTLSLENFQA
DPLGTLSRGWGLFSSAVTKSFEDVNETVIKPHVQQWQSGELSEETKRAAAQFGQKFQETS
SYGFQAFSNFTKNFNGNAEDSSTAGNTTHTEYQKIDNNDKKNEQDEDKWDDF
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtcagattggaaagtggacccagatacccgcaggcgtcttttgcaattgcaaaagatt
ggtgcaaataagaaatgtatggattgtggtgcgccaaatccacaatgggccacgcctaag
tttggagctttcatttgccttgaatgtgccggtatccatagagggcttggtgtgcatata
tcttttgtaagatctatcactatggatcagtttaaaccggaggaacttcttcgtatggaa
aaaggtggtaacgaacctttgactgaatggttcaagtcgcataatattgacctgagttta
ccacaaaaagtgaaatacgataaccccgtcgcagaggattataaagaaaagttaacatgt
ctttgcgaagatagagtatttgaagagcgtgagcatttggattttgatgcttccaagtta
tcagcaacctctcaaaccgctgcatccgctacgcctggtgttgctcaaagtcgagaaggg
acaccactggagaaccgtcgatctgcaacaccagcaaactctagtaatggtgccaatttt
caaaaggagaagaacgaagcttattttgctgagctgggcaagaagaaccaatctagacca
gatcatttgcccccttctcaaggtggtaaatatcagggctttggaagtacacccgcaaaa
cctccacaagaacggtctgcagggtccagcaatactttgagcctggaaaattttcaagct
gatcctttgggaacattgagcagaggatggggcctcttctccagcgctgtaaccaaatcg
ttcgaggacgtaaacgaaacggttattaagcctcacgtccagcaatggcaatccggagag
ttgtcagaagaaacgaagagagcagctgcccagtttggccaaaagtttcaagaaacgagt
agttatggattccaagcatttagtaacttcactaaaaatttcaatggtaatgcagaggat
agctctacagcagggaatacaacccatacagaatatcaaaagattgataataacgataag
aagaatgaacaggacgaggacaaatgggacgatttctaa

DBGET integrated database retrieval system