KEGG   Saccharomyces cerevisiae (budding yeast): YDL227C
Entry
YDL227C           CDS       T00005                                 

Gene name
HO
Definition
(RefSeq) Hop
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB
Motif
Pfam: Hom_end_hint Hom_end LAGLIDADG_3 UPF0556
Other DBs
NCBI-GeneID: 851371
NCBI-ProteinID: NP_010054
SGD: S000002386
UniProt: P09932
Position
IV:complement(46271..48031)
AA seq 586 aa
MLSENTTILMANGEIKDIANVTANSYVMCADGSAARVINVTQGYQKIYNIQQKTKHRAFE
GEPGRLDPRRRTVYQRLALQCTAGHKLSVRVPTKPLLEKSGRNATKYKVRWRNLQQCQTL
DGRIIIIPKNHHKTFPMTVEGEFAAKRFIEEMERSKGEYFNFDIEVRDLDYLDAQLRISS
CIRFGPVLAGNGVLSKFLTGRSDLVTPAVKSMAWMLGLWLGDSTTKEPEISVDSLDPKLM
ESLRENAKIWGLYLTVCDDHVPLRAKHVRLHYGDGPDENRKTRNLRKNNPFWKAVTILKF
KRDLDGEKQIPEFMYGEHIEVREAFLAGLIDSDGYVVKKGEGPESYKIAIQTVYSSIMDG
IVHISRSLGMSATVTTRSAREEIIEGRKVQCQFTYDCNVAGGTTSQNVLSYCRSGHKTRE
VPPIIKREPVYFSFTDDFQGESTVYGLTIEGHKNFLLGNKIEVKSCRGCCVGEQLKISQK
KNLKHCVACPRKGIKYFYKDWSGKNRVCARCYGRYKFSGHHCINCKYVPEAREVKKAKDK
GEKLGITPEGLPVKGPECIKCGGILQFDAVRGPHKSCGNNAGARIC
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgctttctgaaaacacgactattctgatggctaacggtgaaattaaagacatcgcaaac
gtcacggctaactcttacgttatgtgcgcagatggctccgctgcccgcgtcataaatgtc
acacagggctatcagaaaatctataatatacagcaaaaaaccaaacacagagcttttgaa
ggtgaacctggtaggttagatcccaggcgtagaacagtttatcagcgtcttgcattacaa
tgtactgcaggtcataaattgtcagtcagggtccctaccaaaccactgttggaaaaaagt
ggtagaaatgccaccaaatataaagtgagatggagaaatctgcagcaatgtcagacgctt
gatggtaggataataataattccaaaaaaccatcataagacattcccaatgacagttgaa
ggtgagtttgccgcaaaacgcttcatagaagaaatggagcgctctaaaggagaatatttc
aactttgacattgaagttagagatttggattatcttgatgctcaattgagaatttctagc
tgcataagatttggtccagtactcgcaggaaatggtgttttatctaaatttctcactgga
cgtagtgaccttgtaactcctgctgtaaaaagtatggcttggatgcttggtctgtggtta
ggtgacagtacaacaaaagagccagaaatctcagtagatagcttggatcctaagctaatg
gagagtttaagagaaaatgcgaaaatctggggtctctaccttacggtttgtgacgatcac
gttccgctacgtgccaaacatgtaaggcttcattatggagatggtccagatgaaaacagg
aagacaaggaatttgaggaaaaataatccattctggaaagctgtcacaattttaaagttt
aaaagggatcttgatggagagaagcaaatccctgaatttatgtacggcgagcatatagaa
gttcgtgaagcattcttagccggcttgatcgactcagatgggtacgttgtgaaaaagggc
gaaggccctgaatcttataaaatagcaattcaaactgtttattcatccattatggacgga
attgtccatatttcaagatctcttggtatgtcagctactgtgacgaccaggtcagctagg
gaggaaatcattgaaggaagaaaagtccaatgtcaatttacatacgactgtaatgttgct
gggggaacaacttcacagaatgttttgtcatattgtcgaagtggtcacaaaacaagagaa
gttccgccaattataaaaagggaacccgtatatttcagcttcacggatgatttccagggt
gagagtactgtatatgggcttacgatagaaggccataaaaatttcttgcttggcaacaaa
atagaagtgaaatcatgtcgaggctgctgtgtgggagaacagcttaaaatatcacaaaaa
aagaatctaaaacactgtgttgcttgtcccagaaagggaatcaagtatttttataaagat
tggagtggtaaaaatcgagtatgtgctagatgctatggaagatacaaattcagcggtcat
cactgtataaattgcaagtatgtaccagaagcacgtgaagtgaaaaaggcaaaagacaaa
ggcgaaaaattgggcattacgcccgaaggtttgccagttaaaggaccagagtgtataaaa
tgtggcggaatcttacagtttgatgctgtccgcgggcctcataagagttgtggtaacaac
gcaggtgcgcgcatctgctaa

DBGET integrated database retrieval system