KEGG   Saccharomyces cerevisiae (budding yeast): YDL229WHelp
Entry
YDL229W           CDS       T00005                                 

Gene name
SSB1, YG101
Definition
(RefSeq) Hsp70 family ATPase SSB1
Organism
sce  Saccharomyces cerevisiae (budding yeast)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C
Motif
Other DBs
NCBI-GeneID: 851369
NCBI-ProteinID: NP_010052
SGD: S000002388
UniProt: P11484
Structure
PDB: 

Position
IV:44065..45906
Genome map
AA seq 613 aa AA seqDB search
MAEGVFQGAIGIDLGTTYSCVATYESSVEIIANEQGNRVTPSFVAFTPEERLIGDAAKNQ
AALNPRNTVFDAKRLIGRRFDDESVQKDMKTWPFKVIDVDGNPVIEVQYLEETKTFSPQE
ISAMVLTKMKEIAEAKIGKKVEKAVITVPAYFNDAQRQATKDAGAISGLNVLRIINEPTA
AAIAYGLGAGKSEKERHVLIFDLGGGTFDVSLLHIAGGVYTVKSTSGNTHLGGQDFDTNL
LEHFKAEFKKKTGLDISDDARALRRLRTAAERAKRTLSSVTQTTVEVDSLFDGEDFESSL
TRARFEDLNAALFKSTLEPVEQVLKDAKISKSQIDEVVLVGGSTRIPKVQKLLSDFFDGK
QLEKSINPDEAVAYGAAVQGAILTGQSTSDETKDLLLLDVAPLSLGVGMQGDMFGIVVPR
NTTVPTIKRRTFTTCADNQTTVQFPVYQGERVNCKENTLLGEFDLKNIPMMPAGEPVLEA
IFEVDANGILKVTAVEKSTGKSSNITISNAVGRLSSEEIEKMVNQAEEFKAADEAFAKKH
EARQRLESYVASIEQTVTDPVLSSKLKRGSKSKIEAALSDALAALQIEDPSADELRKAEV
GLKRVVTKAMSSR
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaggtgttttccaaggtgctatcggtatcgatttaggtacaacctactcttgt
gttgctacttacgaatcctccgttgaaattattgccaacgaacaaggtaacagagtcacc
ccatctttcgttgctttcactccagaagaaagattgattggtgatgctgccaagaaccaa
gctgctttgaacccaagaaacactgtcttcgatgctaagcgtttgattggtagaagattc
gacgacgaatctgttcaaaaggacatgaagacctggcctttcaaggttatcgacgtcgat
ggtaacccagtcatcgaagtccaatacttggaagaaaccaagactttctccccacaagaa
atttccgctatggttttgaccaagatgaaggaaattgctgaagctaagattggtaagaag
gttgaaaaggccgtcattactgtcccagcttactttaacgacgctcaaagacaagctacc
aaggatgccggtgccatttctggtttgaacgttttgcgtatcatcaacgaacctactgcc
gctgctattgcttacggtctaggtgctggtaagtccgaaaaggaaagacatgttttgatt
ttcgatttgggtggtggtactttcgatgtttccttgttgcacattgctggtggtgtttac
actgttaaatctacttccggtaacactcacttgggtggtcaagatttcgacaccaacttg
ttggaacacttcaaggctgaattcaagaagaagactggtttggacatctccgacgatgcc
agagctttgagaagattgagaactgctgctgaaagagctaagagaaccttatcttctgtc
actcaaactaccgttgaagttgactctttgtttgacggtgaagatttcgaatcctctttg
actagagctagatttgaagacttgaacgccgcattgttcaagtctactttggaacctgtt
gaacaagttttgaaggatgctaagatctctaagtctcaaatcgacgaagttgtcttggtt
ggtggttccaccagaattccaaaggtccaaaagttgttgtctgacttctttgacggtaag
caattggaaaaatctattaacccagatgaagctgttgcttacggtgctgctgttcaaggt
gctatcttgaccggccaatccacatctgacgaaaccaaggacttgttgttgttagatgtt
gctccattatctctaggtgttggtatgcaaggtgacatgttcggtatcgttgttccaaga
aacactactgttccaaccatcaagagaagaacctttactacatgtgctgacaaccaaacc
accgttcaattcccagtctaccaaggtgaacgtgttaactgtaaagaaaacactttgttg
ggtgaattcgacttgaagaacatcccaatgatgccagctggtgaaccagtcttggaagct
atcttcgaagttgatgctaacggtatcttgaaggttactgccgtcgaaaagtctaccggt
aagtcttctaacatcactatctctaacgctgttggtagattgtcttctgaagaaattgaa
aagatggttaaccaagctgaagagttcaaggctgccgatgaagcttttgccaagaagcac
gaagctagacaaagattggaatcctacgttgcctccatcgaacaaactgtcactgaccca
gtcttgtcttctaaattgaagagaggttccaagtccaagattgaagctgctttgtccgat
gctttggctgctttgcaaatcgaagacccatctgctgatgaattgagaaaggctgaagtt
ggtttgaagagagttgtcaccaaggccatgtcttctcgttaa

DBGET integrated database retrieval system